DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and F59B1.8

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:318 Identity:73/318 - (22%)
Similarity:132/318 - (41%) Gaps:83/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IPKCYSARHDLLIMEDLRERGFQMSD-------RH--KGLSLEETQSVLLQVAQLHGLSLAYK-- 187
            :||.:.::.   ..||...:||...:       ||  :.::::|.|.:|..:|:|..|||:.:  
 Worm   139 LPKVFFSQK---FEEDNPNKGFVGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTESC 200

  Fly   188 --------FEKPLEFSNLCSMISE----GIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYV 240
                    ||:     :|..|:||    |||..:     ||..::|::..     |.:..:.|.:
 Worm   201 RNLDNGEAFEE-----SLMDMLSEDGLKGIFDQS-----RNIDQKLSEKV-----ERIEQNHKEI 250

  Fly   241 LAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYS 305
            |.:......:...|...|:         |||||.|..|.|:   .:.....:...:||:|.....
 Worm   251 LNLETVLNLNKVVGIDQKV---------ICHGDLWAANILW---TQTDGGFIADKVLDYQESHMG 303

  Fly   306 SIALDIANLLYCCTTKEMRDAQLQTLLK----IYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAE 366
            :.|.|:..||....:...|.:..:.:|:    .:|:|:.      ..|.|   .||::|:..|  
 Worm   304 NPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIG------SNNAP---YTLEQLKTSF-- 357

  Fly   367 ELKTY---GRFAL----GLALD--ILPISTCSSEDAPDMYLDRSDELGEDVGAPTLNF 415
              |.|   |...|    |.|:|  :..:.:..:|:...:.:::.|.|.:||    |||
 Worm   358 --KLYFPVGALTLISLFGPAVDMKLQGMESGKAENYRRIVIEKVDCLLDDV----LNF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 52/238 (22%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 73/318 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.