DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7985 and HEXD

DIOPT Version :9

Sequence 1:NP_001262699.1 Gene:CG7985 / 42178 FlyBaseID:FBgn0028499 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_775891.2 Gene:HEXD / 284004 HGNCID:26307 Length:585 Species:Homo sapiens


Alignment Length:396 Identity:166/396 - (41%)
Similarity:228/396 - (57%) Gaps:60/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAHNAYKEDELRDFLE 255
            |||||||||||||:|:|.::.|:.|||||.||||||||||||.|.|:.|.|..||...|:::.|.
Human    10 RLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRAKYAYSPSEIKEILH 74

  Fly   256 CAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQPQSMALLEQMLTQVIELHSQ 320
            .|.|:.|.|:||||||||||:|||.:.|..|||:...|.::.|.:.:|:||:..|:.||:|||  
Human    75 LAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEAESLALVGAMIDQVLELH-- 137

  Fly   321 CLGQATPATNVPVARIRFTHIHIGCDEVQRMGECTTCRQRLRSE------LFLSHVVSMAHFIRR 379
                       |.|:    .:|||||||..:||....|:.|:.|      |.|||:.::|..::.
Human   138 -----------PGAQ----RLHIGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRAVASGVKA 187

  Fly   380 QWPHLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASDIYRFIQPQLWDTYAKV-------- 436
            :.|.:..::|||.||.:...:|..|.|...|||::|.|.:|:         |.:.||        
Human   188 RRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYTADL---------DVHGKVLLMQKYRR 243

  Fly   437 --FPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFSKGLRGLALTGWQRYDHFA 499
              ||..|.|||||||.|.|..|||::|||.|:::||.|   .|...:..|:|:.|||||||||::
Human   244 CGFPQLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQV---AGSGPTDSLQGIILTGWQRYDHYS 305

  Fly   500 VLCELLPVGIPSLMTSLSTVSKGYFSTNPRDN-ELLRVLQCVFQPDSRRSG-------------- 549
            |||||||.|:|||...|..:.:|.|..:.:.. |.|..:..:.:.|..|..              
Human   306 VLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEKTDPVRQAPCSPPCPLLPLPFP 370

  Fly   550 RPWLEL 555
            |||.:|
Human   371 RPWRQL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7985NP_001262699.1 DUF737 78..>170 CDD:283062
GH20_GcnA-like 191..517 CDD:119335 155/341 (45%)
HEXDNP_775891.2 GH20_GcnA-like 9..323 CDD:119335 155/341 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_arCOG07452
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68120
Inparanoid 1 1.050 308 1.000 Inparanoid score I2626
Isobase 1 0.950 - 0 Normalized mean entropy S7178
OMA 1 1.010 - - QHG46370
OrthoDB 1 1.010 - - D1021041at2759
OrthoFinder 1 1.000 - - FOG0003694
OrthoInspector 1 1.000 - - oto88432
orthoMCL 1 0.900 - - OOG6_105415
Panther 1 1.100 - - LDO PTHR21040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7251
SonicParanoid 1 1.000 - - X2558
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.