DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssdp and adn2

DIOPT Version :9

Sequence 1:NP_001262698.1 Gene:Ssdp / 42177 FlyBaseID:FBgn0011481 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_596834.1 Gene:adn2 / 2540193 PomBaseID:SPBC1289.10c Length:743 Species:Schizosaccharomyces pombe


Alignment Length:429 Identity:89/429 - (20%)
Similarity:115/429 - (26%) Gaps:177/429 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SDAQAREKLALYVYEYLLHVGAQKAAQTFLSE------IRWEK---------------------- 48
            :|...:..|..|:|:||:.....:||:.|..|      :|.::                      
pombe    34 ADRTTQSLLNSYIYDYLIKKDYCEAARAFGREAQVQTLVRSQEETNSLAKRHKRMSPVAVKHEGI 98

  Fly    49 ----------NITLGE------------PP--------GFLHTWWCVFWDLYCAAPERRDQCDHS 83
                      |:..|.            ||        |||..||.||||:|.|   ||.|  .|
pombe    99 SNNESSDENMNVNNGNLDSFSSSSAPPPPPILPIDSAGGFLIEWWNVFWDIYNA---RRGQ--GS 158

  Fly    84 SEAKAFHDY----------------------GFVSSGYGVNGIGPGGPHNAGGPAPSPLGQMPPG 126
            ..|||:..:                      |..|..| .|...|..|.||       :||....
pombe   159 EPAKAYMSHISNLRKKSRLNLQEIQKNSLHTGNTSHPY-ANASFPHDPANA-------MGQQIDS 215

  Fly   127 GDGGPMGPGGPMGPN-------FFPNSTMRPSPPTHA---------------------------- 156
            .. ...|.||....|       ...|.:....|||.|                            
pombe   216 SQ-FHQGAGGLNDRNQHLMRQAMLNNQSRETFPPTAAQLQQLKQLHYRQLQSVQQQQKQHQQKKT 279

  Fly   157 ----SSPQPPPSQMMP----GQPPFMGGP-----RYPGGPRPGVRMQGMGNEFNGPPGQPMMPNS 208
                |:||...:...|    ..||...||     ..|..|:.           .|.|.......|
pombe   280 PQSGSTPQMQNTTSQPTTHDTHPPKQQGPISDFRSIPSSPKT-----------EGAPSNAQFRPS 333

  Fly   209 MDPTRPGGGMGPMNPRMNPPRGPGGMGPMGYGGP---------GGMRGPAPGPGGMPPMGMGGAG 264
            : |..|.|.:...||..:.....||..|:.....         ...|.|....||..|      .
pombe   334 L-PATPNGSVPQSNPLYDTTGLNGGQYPVVQNSAQPLLHEINFASNRNPHLKQGGAVP------S 391

  Fly   265 GRPPQWQPNASAPLNA-------YSSSSPGNYGPGSNGP 296
            ...||.|.:...|..|       :|.:....|| .||.|
pombe   392 STLPQQQKSLDKPKPAQQPSTGQFSGNQMNQYG-FSNSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsdpNP_001262698.1 SSDP 81..393 CDD:282372 60/302 (20%)
adn2NP_596834.1 LisH 41..66 CDD:285685 8/24 (33%)
SSDP 304..682 CDD:282372 31/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.