DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssdp and SSBP3

DIOPT Version :9

Sequence 1:NP_001262698.1 Gene:Ssdp / 42177 FlyBaseID:FBgn0011481 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_663768.1 Gene:SSBP3 / 23648 HGNCID:15674 Length:388 Species:Homo sapiens


Alignment Length:456 Identity:235/456 - (51%)
Similarity:262/456 - (57%) Gaps:102/456 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYGKSKTSAVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCV 65
            |:.|.|.||||||.|||||||||||||||||||||:||||||||||||||||||||||||:||||
Human     1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCV 65

  Fly    66 FWDLYCAAPERRDQCDHSSEAKAFHDYGFVSSGYGVNGIGPGGPHNAGGPAPSP-LGQMPPGGDG 129
            |||||||||||||.|:|||||||||||                   :...|||| ||.:|| .||
Human    66 FWDLYCAAPERRDTCEHSSEAKAFHDY-------------------SAAAAPSPVLGNIPP-NDG 110

  Fly   130 GPMGPGGPMGPNFF---PNSTMRPSPPTHASSPQPPPSQMM-PGQPPFMGGPRYPGGPRPGVRMQ 190
               .||||:.|.||   |.|  :|||  ||..|...||.|| |...||| .|||.|||||.:|  
Human   111 ---MPGGPIPPGFFQGPPGS--QPSP--HAQPPPHNPSSMMGPHSQPFM-SPRYAGGPRPPIR-- 165

  Fly   191 GMGNEFNGPPG-----QPMMPNSMDPTRPGG--GMGPMNPRMNPPR--GPGGMGPMGYGGPGGMR 246
             |||:   |||     ||::||||||||..|  .||....||||||  ||.|.||..||  .|||
Human   166 -MGNQ---PPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYG--SGMR 224

  Fly   247 GP--APGPGGMPPMGMGGAGGRPPQWQPNASAPLNAYSSSSPGNY--GPGSNGPPGPGTPIMPSP 307
            .|  :.|| .||.:.||...|||  |....||....|||||||.|  .||..||  |||||||||
Human   225 PPPNSLGP-AMPGINMGPGAGRP--WPNPNSANSIPYSSSSPGTYVGPPGGGGP--PGTPIMPSP 284

  Fly   308 QDNTQGGPVGGPGDSMYALMKP--------EFPMGGGPDGGGGGGGPGGMGPMGG-GPNSMGPVL 363
            .|:|..      .|::|.::.|        .||||.|.|        |.||.||| .|:.|    
Human   285 ADSTNS------SDNIYTMINPVPPGGSRSNFPMGPGSD--------GPMGGMGGMEPHHM---- 331

  Fly   364 NGGGGPDGSG-LDGM-KNSPAN-----GGPGTPREDSGSGMGDYNLGGFGGPGENDQTESAAILK 421
               .|..||| :||: ||||.|     ..|||||:|...|      |.|....:||....:..:.
Human   332 ---NGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELG------GNFLHSFQNDNYSPSMTMS 387

  Fly   422 I 422
            :
Human   388 V 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsdpNP_001262698.1 SSDP 81..393 CDD:282372 157/345 (46%)
SSBP3NP_663768.1 LisH 17..43 CDD:128913 24/25 (96%)
SSDP 81..365 CDD:398282 157/345 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..388 148/335 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3173
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23411
Inparanoid 1 1.050 351 1.000 Inparanoid score I2275
Isobase 1 0.950 - 0 Normalized mean entropy S4617
OMA 1 1.010 - - QHG45948
OrthoDB 1 1.010 - - D387814at33208
OrthoFinder 1 1.000 - - FOG0001190
OrthoInspector 1 1.000 - - otm40276
orthoMCL 1 0.900 - - OOG6_107792
Panther 1 1.100 - - O PTHR12610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X810
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.