DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrd and PPP2R5B

DIOPT Version :9

Sequence 1:NP_732295.1 Gene:wrd / 42169 FlyBaseID:FBgn0042693 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_006235.1 Gene:PPP2R5B / 5526 HGNCID:9310 Length:497 Species:Homo sapiens


Alignment Length:460 Identity:283/460 - (61%)
Similarity:353/460 - (76%) Gaps:16/460 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PGHPAGLQPSP----------QTLQQLTGSPGRARDRNLFYTPPTASVAMALPALRETAASEREE 479
            |..| ||.|.|          ::|::  ..|.|:...:.|...........||.|::..|||..|
Human    14 PSSP-GLSPVPPPDKVDGFSRRSLRR--ARPRRSHSSSQFRYQSNQQELTPLPLLKDVPASELHE 75

  Fly   480 LFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRT 544
            |..:|:.||..:|||.:.::|||.||||||||:|:|:.:.:..||:.|.:||:.|.|.:||:|||
Human    76 LLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGVLIEPVYPDIIRMISVNIFRT 140

  Fly   545 LPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLF 609
            ||||.||   |||||||||.||.||||||||||.|||||||||||||:|||::|.:|||.||:||
Human   141 LPPSENP---EFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPDFQPSVAKRYVDQKFVLMLLELF 202

  Fly   610 DSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFA 674
            ||||||||::|||:|||:|||||||||:||||.|::|.|||||.||.||:|||||||||||||||
Human   203 DSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFLRFIYEFEHFNGVAELLEILGSIINGFA 267

  Fly   675 LPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPSLSEAVIKSLLKFWPKTHSPKE 739
            ||||.||||||::||:|||..|||||:|.||.||||||||||.:|:|.||:.|||:||||.:.||
Human   268 LPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKE 332

  Fly   740 VMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVI 804
            ||||.|:||:||||||::|.|:..|||:|:|:|||||||||||||||:||||||:|||.||...:
Human   333 VMFLGEMEEILDVIEPSQFVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTV 397

  Fly   805 LPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQ 869
            ||.:|..|.:.||.|||:||..||||.||.|||::.:||||.:.:||.|||.|::|..:|:||||
Human   398 LPAVFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQ 462

  Fly   870 QVESL 874
            .:|.|
Human   463 GLEEL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrdNP_732295.1 B56 474..875 CDD:279883 270/401 (67%)
PLN00122 <780..879 CDD:215064 56/95 (59%)
PPP2R5BNP_006235.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/43 (23%)
B56 69..467 CDD:279883 269/400 (67%)
PLN00122 <373..467 CDD:215064 55/93 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D345293at33208
OrthoFinder 1 1.000 - - FOG0000226
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100293
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3
SonicParanoid 1 1.000 - - X167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.