DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrd and Twdlalpha

DIOPT Version :9

Sequence 1:NP_732295.1 Gene:wrd / 42169 FlyBaseID:FBgn0042693 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:319 Identity:77/319 - (24%)
Similarity:115/319 - (36%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PEAAAGGAAGSGAPTTSSSPSSSS-----TSSNSSASALSSLSQAASSSLASAAANSSASSSAAT 187
            |:....|:..||:.|||.|...||     ..|:||.::...|....::|:.|...:|||..|.:.
  Fly    18 PQGYNYGSGVSGSLTTSGSSGGSSGGFLTAPSHSSVASYGPLGAFQTASVGSLVGSSSAPHSVSH 82

  Fly   188 YGGGANSAA---------AALIASSPFGSQSSTSSLSLSSNAGMSKNAAGAGSGSGSGTTST--- 240
            |||| |.|.         ||..::...|:..||.....:.:.|.|.|..|: |.:|.|.|..   
  Fly    83 YGGG-NGATYTTGGGNGHAATYSTGGHGATYSTGGNGATYSTGGSSNYGGS-SFTGFGPTPNIGF 145

  Fly   241 GAASGSNSLVSTLAQ-------------HFSAATSAAASAAAAAASSASAASSSSASSSSTATNN 292
            ||.:|..:......|             |....|.||.........|..........:.......
  Fly   146 GALAGYQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAPEEHENLERSKHLVIGRPQKNYRVVFIK 210

  Fly   293 AASSSIAASKSPVSAAAAIKNILNATKSVGTSAAAAAAAAATSSSSSPSSAAAVPSSAATAVAAV 357
            |.|||.|..|  :||..|.|.    .|:|....:........:..::|  |..|||.........
  Fly   211 APSSSNANVK--LSAEYAPKE----EKTVIYVLSKKDNQLEVNDIATP--APTVPSKPEVFFIKY 267

  Fly   358 PTTSDVPAEEMRPTVAQNLVGGISISLGIGQRNGGAAPASSAVMVTPNATMVVTTSSLS 416
            .|.::....:.:.....:.:.|.|     ..::||.|||.|.|.:.....:...:|..|
  Fly   268 KTDAEASHAQQQIQAEYDRIEGTS-----EHQDGGVAPAQSVVGILDGGAIGAASSGSS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrdNP_732295.1 B56 474..875 CDD:279883
PLN00122 <780..879 CDD:215064
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2085
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.