DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrd and Ppp2r5e

DIOPT Version :9

Sequence 1:NP_732295.1 Gene:wrd / 42169 FlyBaseID:FBgn0042693 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_036154.1 Gene:Ppp2r5e / 26932 MGIID:1349473 Length:467 Species:Mus musculus


Alignment Length:479 Identity:300/479 - (62%)
Similarity:366/479 - (76%) Gaps:28/479 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 SSAVMVTPNATMVVTTSSLSIRQNGDILPGHPAGLQPSPQTLQQLTGSPGRARDRNLFYTPPTAS 461
            |||....|:...|...|..|:|:          ..|...|:..|.     |::.:.:..||    
Mouse     2 SSAPTTPPSVDKVDGFSRKSVRK----------ARQKRSQSSSQF-----RSQGKPIELTP---- 47

  Fly   462 VAMALPALRETAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVIT 526
                ||.|::...||:.|||::|:||||.:|||.:.|||||.||.||:.|:|:||::|...|.:|
Mouse    48 ----LPLLKDVPTSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLT 108

  Fly   527 EVIYPEAINMFAVNLFRTLPPS-SNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQP 590
            |..|||.:.|.:.|:||||||| ||    ||||||||||||:||||||||||.|:|||||.:|||
Mouse   109 EQTYPEVVRMVSCNIFRTLPPSDSN----EFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP 169

  Fly   591 SMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEH 655
            |:||::||.:||||||:|||||||||||:|||||||||||||||||||||||||:|.||:|||||
Mouse   170 SIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEH 234

  Fly   656 HNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPSLS 720
            .||:|||||||||||||||||||.||||||:|||:|||..:|||::|.||.||:||||||||||:
Mouse   235 FNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLT 299

  Fly   721 EAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERAL 785
            |.||:.|:||||||.|.||||||.||||:||||||::|.|:..|||:||||||||||||||||||
Mouse   300 EPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVAERAL 364

  Fly   786 YYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNY 850
            ||||||||||||.:||.|||||||.:|.|.||.|||..|..|:||.||.|||::..:|||.:..|
Mouse   365 YYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSTMFDELTATY 429

  Fly   851 KQEKQMEREKLSQREELWQQVESL 874
            |.::|.|::|..:|||||:::|.|
Mouse   430 KSDRQREKKKEKEREELWKKLEDL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrdNP_732295.1 B56 474..875 CDD:279883 283/402 (70%)
PLN00122 <780..879 CDD:215064 58/95 (61%)
Ppp2r5eNP_036154.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 12/51 (24%)
B56 2..>67 CDD:421517 22/87 (25%)
B56 55..435 CDD:396263 273/383 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D345293at33208
OrthoFinder 1 1.000 - - FOG0000226
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100293
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3
SonicParanoid 1 1.000 - - X167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.