DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrd and Y39B6A.13

DIOPT Version :10

Sequence 1:NP_732295.1 Gene:wrd / 42169 FlyBaseID:FBgn0042693 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_741685.1 Gene:Y39B6A.13 / 189731 WormBaseID:WBGene00012675 Length:208 Species:Caenorhabditis elegans


Alignment Length:181 Identity:29/181 - (16%)
Similarity:63/181 - (34%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKDTPKTPEELLSFMQARGFMQIDEIIDVKSCISFKFYITHDSTQKCFRH---RCKDNVVLSEFD 85
            |:|.|....||....:    ::..:|.:.:.|.|        ||:..:..   :.:..|:..:.:
 Worm   137 LEDIPNLANELKFISE----LKPSKIYEEEQCSS--------STEGYYNSDLPKPRKLVLKQDLN 189

  Fly    86 CTLWNQVKENPENALASNKSLTRKVRNHISTSKSRPAKTDGEVKESIIESYSVKPDTCTVYTKIK 150
            |.        |::...|.:|:..|. .|......:..:::.:.|..|::.....|........::
 Worm   190 CL--------PDSETESEESVNEKT-EHSEFENDKTEQSESDAKTEILKKKKRTPSRHVAELSLE 245

  Fly   151 SV-----LSTIECWR----------KNCKDEFSV---------RIQCKLFD 177
            .:     |:.:|..|          |.|: ||.:         .:.|.:.|
 Worm   246 ELSKYFDLTIVEASRNLKVGLTVLKKKCR-EFGIPRWPHRKIKSLDCLIHD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrdNP_732295.1 B56 475..875 CDD:460264
Y39B6A.13NP_741685.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.