DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrd and Y39B6A.13

DIOPT Version :9

Sequence 1:NP_732295.1 Gene:wrd / 42169 FlyBaseID:FBgn0042693 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_741685.1 Gene:Y39B6A.13 / 189731 WormBaseID:WBGene00012675 Length:208 Species:Caenorhabditis elegans


Alignment Length:216 Identity:44/216 - (20%)
Similarity:79/216 - (36%) Gaps:82/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 GAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRER 617
            |.|.:.|  .|.:.:.:|      :...:||.:..|.||..:.|.:..|:|:::|||.||.|:..
 Worm    57 GKEVNRE--NPQISAQFP------DFLFKFLHAFQFLPSDQQTFANSMFLLKIIDLFGSECPKII 113

  Fly   618 DFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHK 682
            :|                       :.:.|           |:.|||:..::             
 Worm   114 NF-----------------------SEISY-----------ISRLLELATNV------------- 131

  Fly   683 QFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPSLSEAVIKSLLKFWPKTHSP-----KEVMF 742
              |||.|.    ..|:::|            .||....:...:.||.....:..|     ||..|
 Worm   132 --LLKDLF----ENSVNLY------------PKDGKFRKIGARDLLDGVVMSEEPEDGKYKEKSF 178

  Fly   743 LNELEELLDVIEP---AEFQK 760
            |....:|:: :||   ::|::
 Worm   179 LKMKTKLME-LEPRGNSDFER 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrdNP_732295.1 B56 474..875 CDD:279883 44/216 (20%)
PLN00122 <780..879 CDD:215064
Y39B6A.13NP_741685.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.