DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp20 and CBP20

DIOPT Version :9

Sequence 1:NP_524396.1 Gene:Cbp20 / 42166 FlyBaseID:FBgn0022943 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001078705.1 Gene:CBP20 / 834443 AraportID:AT5G44200 Length:257 Species:Arabidopsis thaliana


Alignment Length:142 Identity:88/142 - (61%)
Similarity:119/142 - (83%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTP 70
            :||:|||:.|.|::.|.:.:||.|.|:|:||:||||||||::|||||.|:::.|:|||||..|||
plant    10 KLSAYRDRRFSGTQEEFDEALRASTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTP 74

  Fly    71 CGFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAG 135
            ||||||.:|.|.:.|.|:::::||.||||.||||:|.||.||||:|||::|||||||||||||..
plant    75 CGFCFVLFYSREDTEDAVKYISGTILDDRPIRVDFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPA 139

  Fly   136 RGGYGKLLSQKI 147
            |||||||:.:::
plant   140 RGGYGKLVQKEL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp20NP_524396.1 RRM_NCBP2 32..109 CDD:409686 47/76 (62%)
CBP20NP_001078705.1 RRM <33..>118 CDD:223796 53/84 (63%)
RRM_NCBP2 36..113 CDD:240686 47/76 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2277
eggNOG 1 0.900 - - E1_KOG0121
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 197 1.000 Inparanoid score I1331
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1421503at2759
OrthoFinder 1 1.000 - - FOG0004394
OrthoInspector 1 1.000 - - oto3119
orthoMCL 1 0.900 - - OOG6_102337
Panther 1 1.100 - - LDO PTHR18847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3112
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.