DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp20 and ncbp2

DIOPT Version :9

Sequence 1:NP_524396.1 Gene:Cbp20 / 42166 FlyBaseID:FBgn0022943 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001006879.1 Gene:ncbp2 / 448671 XenbaseID:XB-GENE-1005786 Length:153 Species:Xenopus tropicalis


Alignment Length:139 Identity:113/139 - (81%)
Similarity:126/139 - (90%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKT 69
            ||||.||||||:|:||:||..|:.|||||||||||||||||||||||:.|||:.|||||||.|||
 Frog    12 VELSQYRDQHFRGNRSDQECLLKHSCTLYVGNLSFYTTEEQIHELFSKSGDVKKIVMGLDKIKKT 76

  Fly    70 PCGFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDA 134
            .|||||||||.|::||.||||:||||||||:||.||||||.|||||||||:|||||||||.||||
 Frog    77 ACGFCFVEYYTRTDAEQAMRFINGTRLDDRIIRTDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDA 141

  Fly   135 GRGGYGKLL 143
            |||||||::
 Frog   142 GRGGYGKIV 150

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Cbp20NP_524396.1 RRM_NCBP2 32..109 CDD:409686 63/76 (83%)
ncbp2NP_001006879.1 RRM_NCBP2 39..116 CDD:240686 63/76 (83%)
mRNA cap-binding. /evidence=ECO:0000250 109..113 2/3 (67%)
mRNA cap-binding. /evidence=ECO:0000250 120..124 3/3 (100%)