DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp20 and NCBP2L

DIOPT Version :9

Sequence 1:NP_524396.1 Gene:Cbp20 / 42166 FlyBaseID:FBgn0022943 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001335301.1 Gene:NCBP2L / 392517 HGNCID:31795 Length:153 Species:Homo sapiens


Alignment Length:138 Identity:88/138 - (63%)
Similarity:111/138 - (80%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKK 68
            ::|||.|||..|.|.:.:||:.|::|.||.:||||||||||:||||||| .|:|.|.|||||.||
Human    13 ALELSCYRDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFSR-SDIRNIFMGLDKIKK 76

  Fly    69 TPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYD 133
            |.|||||||.:.|::||.||||:.||.||:.:|..|||.||.||:||||||:|||||||:|.|:.
Human    77 TACGFCFVECHNRADAENAMRFLTGTCLDEWIICTDWDVGFREGQQYGRGKSGGQVRDEFREDFH 141

  Fly   134 AGRGGYGK 141
            :||||:|:
Human   142 SGRGGFGR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp20NP_524396.1 RRM_NCBP2 32..109 CDD:409686 51/76 (67%)
NCBP2LNP_001335301.1 RRM_NCBP2 44..117 CDD:240686 50/73 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147346
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S478
OMA 1 1.010 - - QHG56745
OrthoDB 1 1.010 - - D1421503at2759
OrthoFinder 1 1.000 - - FOG0004394
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18847
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.