DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp20 and SPBC13A2.01c

DIOPT Version :9

Sequence 1:NP_524396.1 Gene:Cbp20 / 42166 FlyBaseID:FBgn0022943 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_596414.1 Gene:SPBC13A2.01c / 2539791 PomBaseID:SPBC13A2.01c Length:182 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:73/135 - (54%)
Similarity:101/135 - (74%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPC 71
            :|.|..:.||......:...:.:| :||||||||||||||:.|||:||::|.|:||:|::.||||
pombe    10 VSPYLIRRFKNDLRALDAVKQSNC-VYVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPC 73

  Fly    72 GFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGR 136
            |||||||:...:|..::::::.|.||:|:||.|.|.|:.||||||||.:|||||||.|.::|.||
pombe    74 GFCFVEYFENQDALDSLKYISRTSLDERIIRADLDHGYEEGRQYGRGASGGQVRDEMREEFDPGR 138

  Fly   137 GGYGK 141
            |||.|
pombe   139 GGYAK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp20NP_524396.1 RRM_NCBP2 32..109 CDD:409686 44/76 (58%)
SPBC13A2.01cNP_596414.1 RRM <29..>119 CDD:223796 51/90 (57%)
RRM_NCBP2 34..111 CDD:240686 44/76 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1866
eggNOG 1 0.900 - - E1_KOG0121
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103828
Inparanoid 1 1.050 161 1.000 Inparanoid score I1237
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004394
OrthoInspector 1 1.000 - - oto101383
orthoMCL 1 0.900 - - OOG6_102337
Panther 1 1.100 - - LDO PTHR18847
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R799
SonicParanoid 1 1.000 - - X3112
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.