DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and FZF1

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:62/260 - (23%)
Similarity:98/260 - (37%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1034 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRI--CMRSFSRSDHLTTHIRTHTGEKPFSC 1096
            |.|.|..:.|::.::|...|.:|...||.|||:.|..  |.:.|.|..||..|..||:..||.:|
Yeast    10 RNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKAC 74

  Fly  1097 DICGRKFARSDEKKRHAKVH-----LKQRI--KKEKVR-------------------------GE 1129
            .:|.::|..:.:.:||...|     |..||  |.|.|.                         ||
Yeast    75 TLCQKRFVTNQQLRRHLNSHERKSKLASRIDRKHEGVNANVKAELNGKEGGFDPKLPSGSPMCGE 139

  Fly  1130 QQQQQQQQQQQQQQQQQQQLQQQQEQHHLSLQQHQQYQQHHL----------------LHSADLA 1178
            :..|.........|..|...:..|:....:........|||:                |.:::.:
Yeast   140 EFSQGHLPGYDDMQVLQCPYKSCQKVTSFNDDLINHMLQHHIASKLVVPSGDPSLKESLPTSEKS 204

  Fly  1179 IVTSSASMXRLE------NSASSVDQ--AQTPTPTPAPAATQKVSLALALDLDESAFPFELTSDY 1235
            ..|.:.|:.:|.      :|:.|||.  |||||...:..:..:...:...:|...|..|:|...|
Yeast   205 SSTDTTSIPQLSFSTTGTSSSESVDSTTAQTPTDPESYWSDNRCKHSDCQELSPFASVFDLIDHY 269

  Fly  1236  1235
            Yeast   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 6/23 (26%)
C2H2 Zn finger 1038..1060 CDD:275368 5/21 (24%)
zf-H2C2_2 1052..1077 CDD:290200 10/26 (38%)
C2H2 Zn finger 1068..1088 CDD:275368 7/21 (33%)
zf-H2C2_2 1080..1105 CDD:290200 10/24 (42%)
C2H2 Zn finger 1096..1116 CDD:275368 5/19 (26%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 59/255 (23%)
C2H2 Zn finger 17..36 CDD:275368 4/18 (22%)
C2H2 Zn finger 44..66 CDD:275368 7/21 (33%)
C2H2 Zn finger 74..94 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.