DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sr and osr2

DIOPT Version :9

Sequence 1:	NP_001262693.1	Gene:	sr / 42162	FlyBaseID:	FBgn0003499	Length:	1271	Species:	Drosophila melanogaster
Sequence 2:	XP_005173612.1	Gene:	osr2 / 550389	ZFINID:	ZDB-GENE-050417-183	Length:	278	Species:	Danio rerio

Alignment Length:	117	Identity:	38/117 - (32%)
Similarity:	55/117 - (47%)	Gaps:	30/117 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly  1028 KTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCR----------------------- 1069
            :|...||||.|.:  |.:.|.|.|.|..|..||:.:|||:|:
Zfish   154 RTHTDERPYTCDI--CHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHLQES 216

  Fly  1070 -----ICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVH 1116
                 .|.|:|::..:|.||:.|||..|||.|..||:.|.|:.:.:||:..|
Zfish   217 PHKCPTCGRTFNQRSNLKTHLLTHTDLKPFCCGRCGKVFRRNCDLRRHSLTH 268

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sr	NP_001262693.1	zf-C2H2	1036..1060	CDD:278523	8/23 (35%)
		C2H2 Zn finger	1038..1060	CDD:275368	7/21 (33%)
		zf-H2C2_2	1052..1077	CDD:290200	11/52 (21%)
		C2H2 Zn finger	1068..1088	CDD:275368	7/47 (15%)
		zf-H2C2_2	1080..1105	CDD:290200	13/24 (54%)
		C2H2 Zn finger	1096..1116	CDD:275368	7/19 (37%)
osr2	XP_005173612.1	COG5048	<55..>276	CDD:227381	38/117 (32%)
		C2H2 Zn finger	136..156	CDD:275368	0/1 (0%)
		zf-H2C2_2	148..173	CDD:290200	8/20 (40%)
		C2H2 Zn finger	164..184	CDD:275368	7/21 (33%)
		zf-H2C2_2	176..199	CDD:290200	8/22 (36%)
		C2H2 Zn finger	192..212	CDD:275368	1/19 (5%)
		zf-C2H2	218..240	CDD:278523	6/21 (29%)
		C2H2 Zn finger	220..240	CDD:275368	6/19 (32%)
		C2H2 Zn finger	248..268	CDD:275368	7/19 (37%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.940