DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and osr1

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_001006079.1 Gene:osr1 / 450059 ZFINID:ZDB-GENE-070321-1 Length:264 Species:Danio rerio


Alignment Length:283 Identity:82/283 - (28%)
Similarity:124/283 - (43%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   867 SAGFPGLGDLHSSHEQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQQQQQTLVLPGPT 931
            |...|....||.|  .||....::::.   ..|..|||:.........:......|.||..|..|
Zfish     3 SKTLPAPVPLHPS--LQLANYSFLQTS---NGLHLPADHMPSIYSFSALHAVHLHQWTLGYPPFT 62

  Fly   932 SSASSSNAALGVL-----IPKQENYPDM-QPSSNGTGYSG-GSGGSSAAA-----AAAAAAAAAA 984
            ....:.:...|::     :|....:|.: ||:...:  || |||.||.:.     |..||||...
Zfish    63 LPRCTFSKLPGLVDARFPLPSIPLFPHLVQPAKQES--SGPGSGASSKSKPRFDFANLAAAATQD 125

  Fly   985 VQLAEYSPSTSKGH------EILSQVYQQSTVPLKLVPVKPRKYPNR---PSKTPVHERPYACPV 1040
            ..|.....||:.||      ..|..|.:.|:         |.:.|:|   ||||   ::.:.|  
Zfish   126 DALKAEDLSTNNGHVRSPSLGCLLDVAKLSS---------PERKPSRGRLPSKT---KKEFVC-- 176

  Fly  1041 ENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFAR 1105
            :.|.|.|::|..|..|.|.||.::|:.|.||.::|.|.|||..|...|:.||||.|..||:.|.:
Zfish   177 KFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQ 241

  Fly  1106 SDEKKRHAKVHLK-QRIKKEKVR 1127
            |.....|..:|:: :.:|..|::
Zfish   242 SRTLAVHKTLHMQVKELKPAKIK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 10/24 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 9/19 (47%)
zf-H2C2_2 1080..1105 CDD:290200 12/24 (50%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)
osr1NP_001006079.1 zf-C2H2 174..196 CDD:278523 8/23 (35%)
C2H2 Zn finger 176..196 CDD:275368 8/21 (38%)
zf-H2C2_2 188..213 CDD:290200 10/24 (42%)
C2H2 Zn finger 204..224 CDD:275368 9/19 (47%)
zf-H2C2_2 216..239 CDD:290200 11/22 (50%)
C2H2 Zn finger 232..252 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.