DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and egrh-3

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_001368224.1 Gene:egrh-3 / 4363076 WormBaseID:WBGene00044651 Length:320 Species:Caenorhabditis elegans


Alignment Length:430 Identity:109/430 - (25%)
Similarity:154/430 - (35%) Gaps:164/430 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 QQQQQQQQQQQQQQQQQAAGAAPSPYDDGRAAAAAAAQHAELLGL-------------TMDCTPL 854
            |...|..||||||||||    ||.|:.:         |||:|:..             :.|.:.|
 Worm    18 QSSSQHMQQQQQQQQQQ----APHPHQN---------QHAQLINRIISSAYNNQHDNGSFDSSIL 69

  Fly   855 LLKQPPPSYAGASAGFPGLGDLHSSHEQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQ 919
            |..|....:           ||...|:..|.|                                 
 Worm    70 LNGQQKFQF-----------DLFQGHQNHLMQ--------------------------------- 90

  Fly   920 QQQQTLVLPGPTSSASSSNAALGVLIPKQENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAA 984
                              |...|:|            .:|.....||:.|:|:::..|....   
 Worm    91 ------------------NGGGGLL------------GNNQQAPRGGTNGTSSSSTTATTTT--- 122

  Fly   985 VQLAEYSPSTSKGHEILSQVYQQSTVPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSR 1049
                  |....||.                   .|.:.|...:.....|||:.||..:|.:||.|
 Worm   123 ------STKKKKGQ-------------------GPGRRPALDANGMPKERPFVCPRPDCQKRFCR 162

  Fly  1050 SDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 1114
            :|.|.||:||||||:.||||.|:|||||||||..|.|||:.:||:||..|.|:|.:.:|||:|  
 Worm   163 NDHLQRHMRIHTGQRLFQCRTCLRSFSRSDHLAKHERTHSADKPYSCLTCARRFHKHEEKKKH-- 225

  Fly  1115 VHLKQRIKKEKVRGEQQQQQQQQQQQQQQQQQQQLQQQQEQHHLSLQQHQQYQQHHLL------- 1172
                          |::.|.:.:.|||....:|||       :|....|..|....:|       
 Worm   226 --------------EEKCQHKVEDQQQGGAGRQQL-------NLMGNAHNMYPNQMILNGSMQSP 269

  Fly  1173 HSADLAIVTSSASMXRLENSASSVDQAQTP------TPTP 1206
            :|.:|.::..:.:. ....:.....||..|      .|.|
 Worm   270 NSNNLNMMIPATTFKLQGGAGGGASQASAPGGGSSQQPNP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 11/23 (48%)
C2H2 Zn finger 1038..1060 CDD:275368 11/21 (52%)
zf-H2C2_2 1052..1077 CDD:290200 17/24 (71%)
C2H2 Zn finger 1068..1088 CDD:275368 14/19 (74%)
zf-H2C2_2 1080..1105 CDD:290200 13/24 (54%)
C2H2 Zn finger 1096..1116 CDD:275368 8/19 (42%)
egrh-3NP_001368224.1 zf-C2H2 149..173 CDD:395048 11/23 (48%)
C2H2 Zn finger 154..173 CDD:275368 9/18 (50%)
zf-H2C2_2 165..190 CDD:404364 17/24 (71%)
C2H2 Zn finger 181..201 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.