DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and CG3065

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:275 Identity:75/275 - (27%)
Similarity:109/275 - (39%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1033 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCR--ICMRSFSRSDHLTTHIRTHTGEKPFS 1095
            :|.:.||.:||.:.:.:|..|..|:..|||.|||.|.  .|.:.|:|||.|..|:|||||||||.
  Fly   106 KRKFVCPYDNCTKSYGKSSHLRSHLTWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFE 170

  Fly  1096 CDICGRKFARSDEKKRHAKVHLKQ-----------------RIK--KEKVRGEQ----------- 1130
            |..|.:||:|||...:|...|.:|                 |:|  |:::..|.           
  Fly   171 CIQCTKKFSRSDHLTKHLATHDRQLKGSTPKRTVPSSSGGVRLKPPKKQIHSESDSGFHFMAAMV 235

  Fly  1131 ---QQQQQQQQQQQQQQQQQQLQQQQEQHH----LSLQQHQQYQQHHLLHSADLAIVTSSASMXR 1188
               :...:...||||..|.||.....:.||    :.|::.:        ||....||:....|  
  Fly   236 GCGEPSMKHHHQQQQHNQHQQPVSIIDIHHKPIKIKLERPE--------HSDKYQIVSPEHQM-- 290

  Fly  1189 LENSASSVDQAQTPTPTPAPAATQKVSLALALDLDESAFP-------FELTSDYGTLSPLTSPRQ 1246
             :|...  :|:|.|                  |....|.|       .|:.:....|.|...|..
  Fly   291 -DNHGH--NQSQLP------------------DFLNQAKPEVKYEPTEEIVNTLSQLPPADGPGT 334

  Fly  1247 FNYVWVGQDSSQPFF 1261
            :......||  :||:
  Fly   335 YGMPQFVQD--RPFY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 7/23 (30%)
C2H2 Zn finger 1038..1060 CDD:275368 7/21 (33%)
zf-H2C2_2 1052..1077 CDD:290200 11/26 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 9/21 (43%)
zf-H2C2_2 1080..1105 CDD:290200 15/24 (63%)
C2H2 Zn finger 1096..1116 CDD:275368 8/19 (42%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 75/275 (27%)
C2H2 Zn finger 111..133 CDD:275368 7/21 (33%)
zf-C2H2 139..163 CDD:278523 10/23 (43%)
C2H2 Zn finger 141..163 CDD:275368 9/21 (43%)
zf-H2C2_2 155..180 CDD:290200 15/24 (63%)
C2H2 Zn finger 171..191 CDD:275368 8/19 (42%)
zf-C2H2 346..368 CDD:278523 1/2 (50%)
C2H2 Zn finger 348..368 CDD:275368 75/275 (27%)
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.