DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and CG42741

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster


Alignment Length:317 Identity:88/317 - (27%)
Similarity:135/317 - (42%) Gaps:85/317 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 QQQQQQQQAAGAAPSPYDDGRAAAAAAAQHAELLGLTM--DCTPLLLKQPPPSYA-----GASAG 869
            |||||...::|.:..|:....||:.....:..:.|...  ....:.:||...:.:     |:|:|
  Fly    91 QQQQQLYASSGVSKLPFSPFFAASPFFFTYRRISGSGSGNGTGSVSVKQEDNNNSCSYNNGSSSG 155

  Fly   870 FPGLGDLHSSHEQQLQQQQYVRSQPKYQWLD---SPADYAQQQQQVQQVQQQQQQQQTLVLPGPT 931
              |.|...:|      .|.|   :.|:..|.   :|..:|....|..:            ...||
  Fly   156 --GAGSAANS------MQDY---ESKFSLLSLFKNPYKFAGGDGQASR------------KTSPT 197

  Fly   932 SSAS---SSNAALGVLIPKQENYPD-------MQPSSNGTG----------YSG---GSGGSSAA 973
            ..:|   :||::     |..::|..       :.|:..|.|          :||   |.|||:..
  Fly   198 GGSSKPLASNSS-----PSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFG 257

  Fly   974 AAAAAAAAAAAVQLAEYSPSTSKGHEI-------LSQVYQQSTVPLKLVPVKPRKYPNRPSKTPV 1031
            ...::.:.|.    ..|: ..||..::       ..:||.:|:      .:|..|      :|..
  Fly   258 FTTSSDSMAN----GGYN-DLSKNRKVHKCDTEGCDKVYTKSS------HLKAHK------RTHT 305

  Fly  1032 HERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTH 1088
            .|:||.|..|.|..||:||||||||.|.|||.|||:|::|.|||||||||:.|:|.|
  Fly   306 GEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 15/23 (65%)
C2H2 Zn finger 1038..1060 CDD:275368 14/21 (67%)
zf-H2C2_2 1052..1077 CDD:290200 17/24 (71%)
C2H2 Zn finger 1068..1088 CDD:275368 13/19 (68%)
zf-H2C2_2 1080..1105 CDD:290200 5/9 (56%)
C2H2 Zn finger 1096..1116 CDD:275368
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 37/90 (41%)
zf-C2H2 280..304 CDD:278523 5/35 (14%)
C2H2 Zn finger 282..304 CDD:275368 5/33 (15%)
zf-H2C2_2 296..>313 CDD:290200 6/22 (27%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.