DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and ZNF678

DIOPT Version :10

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_848644.2 Gene:ZNF678 / 339500 HGNCID:28652 Length:580 Species:Homo sapiens


Alignment Length:101 Identity:44/101 - (43%)
Similarity:65/101 - (64%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1031 VH--ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKP 1093
            :|  |:||.|  |.|.:.|::...||||.|||||:||:||..|.::|:|..||::|.|.||||||
Human   341 IHTGEKPYKC--EECGKAFTQFASLTRHKRIHTGEKPYQCEECGKTFNRCSHLSSHKRIHTGEKP 403

  Fly  1094 FSCDICGRKFARSDEKKRHAKVHLKQRIKKEKVRGE 1129
            :.|:.|||.|.:.....:|.::|..::..|.|..|:
Human   404 YKCEECGRTFTQFSNLTQHKRIHTGEKPYKCKECGK 439

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:395048 10/23 (43%)
C2H2 Zn finger 1038..1060 CDD:275368 9/21 (43%)
zf-H2C2_2 1052..1077 CDD:463886 15/24 (63%)
C2H2 Zn finger 1068..1088 CDD:275368 8/19 (42%)
zf-H2C2_2 1080..1105 CDD:463886 15/24 (63%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)
ZNF678NP_848644.2 KRAB 43..83 CDD:460171
COG5048 138..536 CDD:227381 44/101 (44%)
C2H2 Zn finger 154..174 CDD:275368
C2H2 Zn finger 182..202 CDD:275368
C2H2 Zn finger 210..230 CDD:275368
C2H2 Zn finger 238..258 CDD:275368
C2H2 Zn finger 266..286 CDD:275368
C2H2 Zn finger 294..314 CDD:275368