DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and odd

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:483 Identity:113/483 - (23%)
Similarity:164/483 - (33%) Gaps:180/483 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 SPDKTMFQPPLFSL-PA-------------HYATMQQQQQQQQQQQQ-----QQQQQQAAGAAPS 826
            :|..|..:.||..: ||             |.|..||||||||||||     |.||||....||.
  Fly    47 TPPHTPTEEPLRRVHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHRLWLQMQQQQQQHQAPQ 111

  Fly   827 PYDDGRAAAAAAAQHAELLGLTMDCTPLLLKQPPPSYAGASAGFPGLGDLHSSHEQQLQQQQYVR 891
            .|                                |.|..|||      |..:.|:|.:.      
  Fly   112 QY--------------------------------PVYPTASA------DPVAVHQQLMN------ 132

  Fly   892 SQPKYQWLDSPADYAQQQQQVQQVQQQQQQ--------QQTLVLPGPTSSASSSNAALGVLIPKQ 948
                 .|:.:.|.|.|||||.|........        ....|.|.|....|...|.:|      
  Fly   133 -----HWIRNAAIYQQQQQQQQHPHHHHHHGHPHHPHPHPHHVRPYPAGLHSLHAAVMG------ 186

  Fly   949 ENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQSTVPLK 1013
            .::..|.     |...||:||:|...:.|..:                                 
  Fly   187 RHFGAMP-----TLKLGGAGGASGVPSGATGS--------------------------------- 213

  Fly  1014 LVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRS 1078
                      :||.|      .:.|  :.|:|:|::|..|..|.|.||.::|:.|.||.::|.|.
  Fly   214 ----------SRPKK------QFIC--KYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ 260

  Fly  1079 DHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEKVRGEQQQQQQQQQQQQQQ 1143
            |||..|...|:.:|||.|..||:.|.:|.....|...||::        |..:....|:...|:.
  Fly   261 DHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEE--------GPHKCPICQRSFNQRA 317

  Fly  1144 QQQQQLQQQQEQHHLSLQQHQQYQQHHLLHSADLAIVTSSASMXRLENSASSVDQAQTPTP---- 1204
            ..:..||...||                 .:.::.:.||.|:...:.|.|.|     :|.|    
  Fly   318 NLKSHLQSHSEQ-----------------STKEVVVTTSPATSHSVPNQALS-----SPQPENLA 360

  Fly  1205 --------TPAPAATQKVSLALALDLDE 1224
                    :.:.::::|....|...:||
  Fly   361 QHLPVLDLSSSSSSSEKPKRMLGFTIDE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 10/24 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 9/19 (47%)
zf-H2C2_2 1080..1105 CDD:290200 11/24 (46%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 44/206 (21%)
C2H2 Zn finger 222..242 CDD:275368 8/21 (38%)
zf-H2C2_2 234..259 CDD:290200 10/24 (42%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
zf-H2C2_2 262..285 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-C2H2 304..326 CDD:278523 4/21 (19%)
C2H2 Zn finger 306..326 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.