DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and cbt

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:527 Identity:116/527 - (22%)
Similarity:173/527 - (32%) Gaps:177/527 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 LPSPDKTMFQPPLFSLPAHYATMQQQQQQQQ------QQQQQQQQQQAAGAAPSPYDDGRAAAAA 837
            ||||..|   |||...........:||..:.      :...|:.|:......|:|.|....|...
  Fly     7 LPSPPAT---PPLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKNGGIITPNPSDTEDEAPEI 68

  Fly   838 AAQHAELLGLTMDCTPLLLKQPPPSYAGASAGFPGLGDLHSSHEQQLQQQQYVRSQPKYQWLDSP 902
            |..:               |:|                       :|:|.....:.|..|.||..
  Fly    69 AVPN---------------KKP-----------------------RLEQPAMSMTPPPDQKLDDD 95

  Fly   903 ADYAQQQQQVQ---------QVQQQQQQQQTLVLPGPTSSASSSNAALGVLIPK-QENYPD---- 953
                |:.::|.         .|....|.:.:.......||:|::|.:...:.|. :::||:    
  Fly    96 ----QKAERVSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSNTNTSTSSVPPTVEDDYPEANVW 156

  Fly   954 ----------------MQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILS 1002
                            :.|..        :..:..|......|.|..::..|..|       ||:
  Fly   157 RNLKFKMNRKRAAEVALPPVQ--------TPETPVAKLVTPPAPAECIKEEEIKP-------ILT 206

  Fly  1003 QVY-------------------QQSTVPLKLVP-VKPRKYPNR---PSKTPVHERPYACPVENCD 1044
            .:|                   |||..|:...| :...|...|   ........|.|.|...:|.
  Fly   207 PIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCG 271

  Fly  1045 RRFSRSDELTRHIRIHTGQKPFQCR--ICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSD 1107
            :.:.:|..|..|.|:|||::||.|:  .|.:.|||||.|:.|.|||||||.|.|.:|.:||.|||
  Fly   272 KNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSD 336

  Fly  1108 EKKRHAKVHLKQRIKKEKVRGEQQQQQQQQQQQQQQQQQQQLQQQQEQHHLSLQQHQQYQQ---- 1168
            ...:|.|.|     .|:|..|..:                         |:||..:.....    
  Fly   337 HLSKHVKRH-----NKDKANGVNR-------------------------HVSLANNNTSASVAAS 371

  Fly  1169 --HHLLHSADLAIVTSSASMXRLENSASSVDQAQTPTPTPAPAATQKVSLALALDLDESAFPFEL 1231
              ...||...:|...||||. .:.:::..|..||.               .|.|....|:|.|. 
  Fly   372 LCDASLHLRAIAPAGSSASSSPISSASLQVYSAQD---------------LLRLQQQASSFTFG- 420

  Fly  1232 TSDYGTL 1238
                |||
  Fly   421 ----GTL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 7/23 (30%)
C2H2 Zn finger 1038..1060 CDD:275368 6/21 (29%)
zf-H2C2_2 1052..1077 CDD:290200 11/26 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 10/21 (48%)
zf-H2C2_2 1080..1105 CDD:290200 14/24 (58%)
C2H2 Zn finger 1096..1116 CDD:275368 9/19 (47%)
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 7/23 (30%)
C2H2 Zn finger 265..287 CDD:275368 6/21 (29%)
COG5048 <270..362 CDD:227381 43/121 (36%)
zf-H2C2_2 279..306 CDD:290200 11/26 (42%)
C2H2 Zn finger 295..317 CDD:275368 10/21 (48%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 10/21 (48%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.