DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and odd-1

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:239 Identity:63/239 - (26%)
Similarity:89/239 - (37%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 EQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQQQQQTLVLPGPTSSASSSNAALGVLI 945
            :|::..|..::||.|              :||.......|...|.:...|:||.:.|||:... |
 Worm    31 QQKIAIQNLLQSQSK--------------EQVNGTSHDLQNWLTSLCISPSSSPTPSNASTST-I 80

  Fly   946 PKQ---ENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQ 1007
            |.|   ||...:|                                            |.||::..
 Worm    81 PAQMTNENVLHLQ--------------------------------------------IQSQLFSN 101

  Fly  1008 STVPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICM 1072
            ...|..|.|.:..|..|...|.|  ::.:.|  :.|.|.|::|..|..|.|.||.::||.|..|.
 Worm   102 LGTPWFLNPEQHNKTNNAIRKRP--KKEFIC--KYCARHFTKSYNLMIHERTHTNERPFHCETCG 162

  Fly  1073 RSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVH 1116
            :||.|.|||..|...|..|||..|:|||:.|.:......|...|
 Worm   163 KSFRRQDHLRDHKYIHAKEKPHKCEICGKGFCQLRTLNVHRSCH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 11/24 (46%)
C2H2 Zn finger 1068..1088 CDD:275368 9/19 (47%)
zf-H2C2_2 1080..1105 CDD:290200 12/24 (50%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 8/21 (38%)
zf-H2C2_2 142..167 CDD:290200 11/24 (46%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
zf-H2C2_2 170..193 CDD:290200 11/22 (50%)
C2H2 Zn finger 186..206 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.