DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and OSR1

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_660303.1 Gene:OSR1 / 130497 HGNCID:8111 Length:266 Species:Homo sapiens


Alignment Length:252 Identity:70/252 - (27%)
Similarity:102/252 - (40%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   902 PADYAQQQQQVQQVQQQQQQQQTLVLPG---PTSSASSSNAALGVLIPKQENYPD-------MQP 956
            |:|:.........:......|.||..|.   |.||.|.....:..|:..:...|.       :||
Human    34 PSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQP 98

  Fly   957 SSNGTGYSGGSGGSSAA------------AAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQST 1009
            ....|     :|||..|            |.||.....|.:...|...|.:.|...|        
Human    99 KPEIT-----AGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGAL-------- 150

  Fly  1010 VPLKLVPVKPRKYPNR---PSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRIC 1071
              |.:..:.|.|.|.|   ||||   ::.:.|  :.|.|.|::|..|..|.|.||.::|:.|.||
Human   151 --LDVTKLSPEKKPTRGRLPSKT---KKEFVC--KFCGRHFTKSYNLLIHERTHTDERPYTCDIC 208

  Fly  1072 MRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK-QRIKKEKVR 1127
            .::|.|.|||..|...|:.||||.|..||:.|.:|.....|..:|.: :.:|..|::
Human   209 HKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 10/24 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 9/19 (47%)
zf-H2C2_2 1080..1105 CDD:290200 12/24 (50%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)
OSR1NP_660303.1 zf-C2H2 175..197 CDD:306579 8/23 (35%)
C2H2 Zn finger 177..197 CDD:275368 8/21 (38%)
zf-H2C2_2 189..214 CDD:316026 10/24 (42%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)
zf-H2C2_2 217..240 CDD:316026 11/22 (50%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.