DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and klf15

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:XP_002938279.1 Gene:klf15 / 100495857 XenbaseID:XB-GENE-854149 Length:394 Species:Xenopus tropicalis


Alignment Length:414 Identity:88/414 - (21%)
Similarity:141/414 - (34%) Gaps:113/414 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 QQLPSPQLGVLAGPMSPPSNSLGNSWGLPSPDKTMFQPPLFSLPAHYATMQQQQQQQQQQQQQQQ 816
            |.|||        |.|...:...:.....|||..:       |.:.|.:....:.|.........
 Frog    32 QMLPS--------PTSEDDSDSSSFRSCSSPDSQV-------LSSSYGSACSAESQDNILDYLLS 81

  Fly   817 QQQAAGAAPSPYDDGRAAAAAAAQHAEL--LGLTMDCTPLLLKQPPPSYAGASAGFPGLGDLHSS 879
            |.....|:.|.:|..|.......:..::  .|:.|:.|...              .|.|.::   
 Frog    82 QTSLGNASLSWWDKRRQQPVVKEEFLKVPEFGVDMEETTFF--------------HPTLDEI--- 129

  Fly   880 HEQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQQQQQTLVLPGPTSSASSS--NAALG 942
                   ::::....|..:.|.....|::.:...|:...         |...:|:...  |....
 Frog   130 -------EEFLEENMKTDFKDEDRHDAKELRTCGQLFSD---------PHAVNSSMKEDINGETI 178

  Fly   943 VLIPKQENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEYS-----------PSTSK 996
            :.:|:.||                :.||.|.:..........:|..|..           |...|
 Frog   179 LSVPEDEN----------------TKGSDAVSVEGGIPVILQIQPIEIKQESNTNQSSQFPENIK 227

  Fly   997 GHEIL-----------SQVYQQSTVPLKLVPVKPRKYPNRP-------------------SKTPV 1031
            ..::|           .|:.|.|.:..|.|.:.|.....:|                   .|.|.
 Frog   228 VAQLLVNIQGQTFALVPQLVQSSNLSSKFVRIAPVPIAAKPVGPGGGIQGQAGVMIGQKFQKNPA 292

  Fly  1032 HE--RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRI--CMRSFSRSDHLTTHIRTHTGEK 1092
            .|  :.:.|....|.:.:::|..|..|:|.|||:|||.|..  |...|||||.|:.|.|:|:|.|
 Frog   293 TELIKMHKCTFPGCTKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVK 357

  Fly  1093 PFSCDICGRKFARSDEKKRHAKVH 1116
            |:.|.:|.:||||||...:|.|||
 Frog   358 PYQCAVCEKKFARSDHLSKHIKVH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 6/23 (26%)
C2H2 Zn finger 1038..1060 CDD:275368 6/21 (29%)
zf-H2C2_2 1052..1077 CDD:290200 12/26 (46%)
C2H2 Zn finger 1068..1088 CDD:275368 10/21 (48%)
zf-H2C2_2 1080..1105 CDD:290200 11/24 (46%)
C2H2 Zn finger 1096..1116 CDD:275368 10/19 (53%)
klf15XP_002938279.1 SFP1 <284..379 CDD:227516 38/94 (40%)
C2H2 Zn finger 301..323 CDD:275368 6/21 (29%)
C2H2 Zn finger 331..353 CDD:275368 10/21 (48%)
zf-H2C2_2 345..370 CDD:372612 11/24 (46%)
C2H2 Zn finger 361..381 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.