DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sr and egr2

DIOPT Version :9

Sequence 1:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster
Sequence 2:NP_001093725.1 Gene:egr2 / 100101746 XenbaseID:XB-GENE-853290 Length:429 Species:Xenopus tropicalis


Alignment Length:455 Identity:153/455 - (33%)
Similarity:196/455 - (43%) Gaps:162/455 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 SQQQASKISYRGIFT----------TTGNAMNAAAAAAAAAAQQQHQQQQQHQQQLPSPQLGVLA 763
            |..::..::|.|.|:          .|....|..:||:.                     |||  
 Frog    81 SAPRSQPLAYMGKFSFDPQYPGAGWNTEGIFNIVSAASI---------------------LGV-- 122

  Fly   764 GPMSPPSNSLGN-----SWGLPSPDKTMFQPP-----LFSLPAHYATMQQQQQQQQQQQQQQQQQ 818
                |||:|...     |.|.|:...:|..|.     ::| |..|::..:..|.           
 Frog   123 ----PPSSSSSTTSSNASSGSPNLSCSMAHPQSDMDHIYS-PPPYSSCNEIYQD----------- 171

  Fly   819 QAAGAAPSPYDDGRAAAAAAAQHAELLGLTMDCTPLLLKQPPPSY---AGASAG--FPGLGDLHS 878
                  ||.: .|.:..|                    ..|||||   .|||.|  ||.:.|..:
 Frog   172 ------PSAF-IGTSTGA--------------------PYPPPSYPSPKGASDGSVFPMIPDYSA 209

  Fly   879 SHEQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQQQQQTLVLPGPTSSASSSNAALGV 943
            ....|.|:.  :.|.|..:....|.|                                     .:
 Frog   210 LFPPQCQRD--LHSMPDRKPFPCPLD-------------------------------------SI 235

  Fly   944 LIPKQENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQS 1008
            .:|     |.:.|.|....::  .||||...:...:|         |||     |.:        
 Frog   236 RVP-----PPLTPLSTIRNFT--LGGSSNEGSRLPSA---------YSP-----HNL-------- 271

  Fly  1009 TVPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMR 1073
              ||:.: ::||||||||||||||||||.||.|.||||||||||||||||||||.||||||||||
 Frog   272 --PLRPI-LRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMR 333

  Fly  1074 SFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEKVRGEQQQQQQQQQ 1138
            :||||||||||||||||||||:||.||||||||||:|||.|:||:|:.:|............|::
 Frog   334 NFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKNSATAAPSGSATQER 398

  Fly  1139  1138
             Frog   399  398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 20/23 (87%)
C2H2 Zn finger 1038..1060 CDD:275368 19/21 (90%)
zf-H2C2_2 1052..1077 CDD:290200 22/24 (92%)
C2H2 Zn finger 1068..1088 CDD:275368 18/19 (95%)
zf-H2C2_2 1080..1105 CDD:290200 22/24 (92%)
C2H2 Zn finger 1096..1116 CDD:275368 16/19 (84%)
egr2NP_001093725.1 DUF3446 92..161 CDD:371803 20/96 (21%)
zf-C2H2 296..320 CDD:333835 20/23 (87%)
C2H2 Zn finger 298..320 CDD:275368 19/21 (90%)
COG5048 324..>391 CDD:227381 50/66 (76%)
C2H2 Zn finger 328..348 CDD:275368 18/19 (95%)
C2H2 Zn finger 356..376 CDD:275368 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11461
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000710
OrthoInspector 1 1.000 - - otm48210
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.