DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14317 and CG7148

DIOPT Version :9

Sequence 1:NP_650675.1 Gene:CG14317 / 42161 FlyBaseID:FBgn0038566 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster


Alignment Length:498 Identity:117/498 - (23%)
Similarity:215/498 - (43%) Gaps:114/498 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALVAQQNNTCSPMEEIEPNYIDNLHIIFFEQIFEEIDNLIDQVRMARAYPQFMPQILKFWQ---- 73
            :|:.|.::.|                  ..:||:.:.:|..:|..||...:.....|..|:    
  Fly     7 SLILQLDDDC------------------LAEIFDRLQDLPSEVSFARTCRRVQYICLSKWRTSHA 53

  Fly    74 -RRLHL----IIGPNTPFLGLLDIDDYVFFMEHMADSFTDLHVHDGVGSFSEFYDYITHLCDINI 133
             .:|.|    ::.||.        :|.|:|:..|.....::      |..|.....:..|.:::|
  Fly    54 YEQLDLEKWRVLLPNH--------EDLVYFLTQMRPYIREM------GGSSCLCSILKDLDEMHI 104

  Fly   134 TKFPKVDTCILAGNPNTV----VDEDIRDLTVMLPNLKRLMTCMNLSGLYMRGFKKLEEL-VFNS 193
            .:.|.|.:...  :|:.|    .:..||.|..:||.||:|.....:.|.|:..|:.|:|| ::..
  Fly   105 AELPMVTSFYY--DPDGVDCYPTNRSIRKLARLLPGLKKLRLTTPIDGRYLSNFQHLQELHLYED 167

  Fly   194 LYHSVPLDSRWIQDICLTMTNLRVLDITD-------QFDSCVRLTDIKLPNLEVLKINLSTVECM 251
            .:.:..|..:::.::|.|:.:||||||..       |..:|::    ...||..||:||:|::.:
  Fly   168 QHKAFELQQKYLDEVCRTLHDLRVLDIRTYDMISKLQLGNCLQ----SFKNLTDLKLNLATLKPI 228

  Fly   252 LSEVLQLPKLQKLSVRFD-----------DSRQLNADQETIFQQIVVAKSERITRIALNNEVVQL 305
            |..||:||.|:||.|..|           ||......:.:.|.:|:..|::.|...|::...:.|
  Fly   229 LPAVLELPSLRKLVVLLDNEWHIPPLVSPDSYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPL 293

  Fly   306 PARWQQSLLLELP-----KLRKVICENWCHNDFFLDRQHMPCQ-QMEVLSFSGWEIVRETQLLEL 364
            ...|.:    :||     :|:::...:|.|:..:|.|  ..|. ::::|....|..:.:..|||.
  Fly   294 EPGWDE----KLPIWTHRRLKRLAICSWTHSADYLKR--YTCMTELQLLCVRNWNDLSDEILLEF 352

  Fly   365 VAECVNLEHLALNGYHSNWEK--LTKLVNIRNQE----------RNPRPLQVFSDMM-WGNFTPE 416
            |..|..||||.:: |..|...  |.:.::|..:.          |:| ||:::.|:. :.:|...
  Fly   353 VELCPRLEHLDVS-YCRNLTPTFLPRALSILKRREPFKQKTGVGRSP-PLKLYYDLSGFEDFVDR 415

  Fly   417 -------EYYHWQSNKYVQVTCD---SSE--YEYQEDGFEFDF 447
                   ||     ..|:..|.|   .||  ..:.:.|::|:|
  Fly   416 ANLKSSLEY-----RGYIVFTADFPVDSERGLSFVDRGYQFEF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14317NP_650675.1 None
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.