DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and AT1G67890

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_564913.1 Gene:AT1G67890 / 843117 AraportID:AT1G67890 Length:765 Species:Arabidopsis thaliana


Alignment Length:303 Identity:99/303 - (32%)
Similarity:158/303 - (52%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 LDS---NWELPRSHLVLGATLGEGAFGRVVMAEVNNAIVAVKMV-KEGHTDDDIASLVREMEVMK 465
            :||   ::|:....|.:|..:|:|:.|.|.......:.||||:. |:.::::.|.|..:|:.:||
plant   473 MDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFKQEVSLMK 537

  Fly   466 IIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITE 530
            .: ||.|::..:|..:....|.::.|:.|.|:|...|.:|:                      ::
plant   538 RL-RHPNVLLFMGAVASPQRLCIVTEFLPRGSLFRLLQRNK----------------------SK 579

  Fly   531 KDL---IKFAHQIARGMDYL--ASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKN 590
            .||   |..|..|||||:||  .|...|||||.:.|:||..::.:|:|||||:| |:...|.  .
plant   580 LDLRRRIHMASDIARGMNYLHHCSPPIIHRDLKSSNLLVDRNWTVKVADFGLSR-IKHETYL--T 641

  Fly   591 TNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEK 655
            ||||...:|||||.|:.:..|.||||:|:|::|||::| .:.|:..:.:.:.:.......||:|.
plant   642 TNGRGTPQWMAPEVLRNEAADEKSDVYSFGVVLWELVT-EKIPWENLNAMQVIGAVGFMNQRLEV 705

  Fly   656 PAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDY 698
            |.........||..|||.....||.|.|:   ||||.:.:..|
plant   706 PKDVDPQWIALMESCWHSEPQCRPSFQEL---MDKLRELQRKY 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 97/295 (33%)
AT1G67890NP_564913.1 PAS 102..>211 CDD:441804
STKc_MAP3K-like 493..738 CDD:270901 91/274 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.