DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and AT5G66710

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_201472.1 Gene:AT5G66710 / 836804 AraportID:AT5G66710 Length:405 Species:Arabidopsis thaliana


Alignment Length:376 Identity:100/376 - (26%)
Similarity:160/376 - (42%) Gaps:89/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 NEYEFPLDSNWELPRSHLVLGATLGEGA--------FGRVVMAEVNNAIVAVKMVKEGHTD---- 451
            :::.|.:::...:....:.:|..:|||:        |.|||.       |:||:.:...|.    
plant    54 DQFAFTINTELLVDVKDISIGDFIGEGSSSTVYRGLFRRVVP-------VSVKIFQPKRTSALSI 111

  Fly   452 DDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGN-LKDFLYKNRPFGRDQDRD 515
            :......||:.::... ||.||:..:|.|.:  |..:|:.....|| |:.|:...||...|.   
plant   112 EQRKKFQREVLLLSKF-RHENIVRFIGACIE--PKLMIITELMEGNTLQKFMLSVRPKPLDL--- 170

  Fly   516 SSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYV-LKIADFGLAR 579
                           |..|.||..|||||::|.:...|||||...|:|::.|.. :|:|||||||
plant   171 ---------------KLSISFALDIARGMEFLNANGIIHRDLKPSNMLLTGDQKHVKLADFGLAR 220

  Fly   580 DIQSTDYYRKNTNGRLPI-----KWMAPESL--------QEKFYDSKSDVWSYGILLWEIMTYGQ 631
            :         .|.|.:..     :|||||..        ::|.||.|.||:|:.|:.||::| .:
plant   221 E---------ETKGFMTFEAGTYRWMAPELFSYDTLEIGEKKHYDHKVDVYSFAIVFWELLT-NK 275

  Fly   632 QPYPTIMSAEELY-TYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTK 695
            .|:   .....:: .|..|..:..........:..:::.||..|.|.||.|.||...:..||::.
plant   276 TPF---KGKNNIFVAYAASKNQRPSVENLPEGVVSILQSCWAENPDARPEFKEITYSLTNLLRSL 337

  Fly   696 EDYLDVDI------ANLDTPPSTSDEEED------------ETDNLQKWCN 728
            ..  |.|.      ||:.|..|||...::            :|..|:|..|
plant   338 SS--DTDATSSNSKANIATEDSTSSLVQERVVCDCPGLKMSKTKKLKKKTN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 85/315 (27%)
AT5G66710NP_201472.1 STKc_MAP3K-like 77..330 CDD:270901 84/293 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.