DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and AT3G50730

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_190642.2 Gene:AT3G50730 / 824237 AraportID:AT3G50730 Length:371 Species:Arabidopsis thaliana


Alignment Length:365 Identity:102/365 - (27%)
Similarity:173/365 - (47%) Gaps:69/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 NGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNNAI-VAVKMVKEGHTDDDI 454
            |.::..||:   |.:.....|.|:.:|:|..:||||:..|....:.|.. ||||::     |...
plant    14 NESDDEPFH---FSISRELLLDRNDVVVGEMIGEGAYSIVYKGLLRNQFPVAVKIM-----DPST 70

  Fly   455 ASLVR-------EMEVMKIIG-RHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRD 511
            .|.|.       :.||:.:.. :|.||:..:|.|.: ..|.::.|....|.|:.|::        
plant    71 TSAVTKAHKKTFQKEVLLLSKMKHDNIVKFVGACIE-PQLIIVTELVEGGTLQRFMH-------- 126

  Fly   512 QDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYV-LKIADF 575
                 |:|.|      :..|..:.||..|:|.|:::.|...|||||..||:||:.|.. :|:|||
plant   127 -----SRPGP------LDLKMSLSFALDISRAMEFVHSNGIIHRDLNPRNLLVTGDLKHVKLADF 180

  Fly   576 GLARDIQSTDYYRKNTNGRLPI-----KWMAPESL---------QEKFYDSKSDVWSYGILLWEI 626
            |:||:         .|.|.:..     ||||||.:         ::|.||.|:|::|:.|:||::
plant   181 GIARE---------ETRGGMTCEAGTSKWMAPEVVYSPEPLRVGEKKEYDHKADIYSFAIVLWQL 236

  Fly   627 MTYGQQPYPTIMSAEELYT-YLMSGQRMEKPAKCSMNIYI-LMRQCWHFNADDRPPFTEIVEYMD 689
            :| .::|:|.:.::  |:. ||:|..|.....| :.:::: ::..||..:.|.||.|.||...:.
plant   237 VT-NEEPFPDVPNS--LFVPYLVSQGRRPILTK-TPDVFVPIVESCWAQDPDARPEFKEISVMLT 297

  Fly   690 KLLQTKEDYLDVDIANLDTPPSTSDEEEDETDNL--QKWC 727
            .||:.......:.....|......:.||.|...|  :.:|
plant   298 NLLRRMSSDSSIGTTLPDGEAYEGEMEESENSPLLQEHFC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 90/313 (29%)
AT3G50730NP_190642.2 STKc_MAP3K-like 42..296 CDD:270901 86/291 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.