DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Lyn

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_110484.1 Gene:Lyn / 81515 RGDID:621017 Length:512 Species:Rattus norvegicus


Alignment Length:304 Identity:115/304 - (37%)
Similarity:163/304 - (53%) Gaps:29/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PAPFNEYEFPLDSN-WELPRSHLVLGATLGEGAFGRVVMAEVNNAI-VAVKMVKEGHTDDDIASL 457
            |.|    :.|.|.: ||:||..:.|...||.|.||.|.|...||:. ||||.:|.|..  ...:.
  Rat   229 PKP----QKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTM--SAQAF 287

  Fly   458 VREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPS 522
            :.|..:||.: :|..::.|....::..|:|:|.|:...|:|.|||        ..|..|.     
  Rat   288 LEEANLMKTL-QHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFL--------KSDEGSK----- 338

  Fly   523 PPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYY 587
                |:..| ||.|:.|||.||.|:..:..|||||.|.|||||:..:.|||||||||.|:..:|.
  Rat   339 ----VLLPK-LIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYT 398

  Fly   588 RKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQR 652
            .:. ..:.||||.|||::....:..||||||:||||:||:|||:.|||...:| ::.|.|..|.|
  Rat   399 ARE-GAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNA-DVMTALSQGYR 461

  Fly   653 MEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKE 696
            |.:...|...:|.:|:.||..:|::||.|..:...:|......|
  Rat   462 MPRMENCPDELYDIMKMCWKESAEERPTFDYLQSVLDDFYTATE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 112/289 (39%)
LynNP_110484.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
SH3_Lyn 67..122 CDD:212937
SH2_Src_Lyn 125..225 CDD:198227
PTKc_Lyn 239..510 CDD:270657 111/290 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.