DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and ntrk3b

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_002662799.4 Gene:ntrk3b / 798577 ZFINID:ZDB-GENE-010126-4 Length:818 Species:Danio rerio


Alignment Length:674 Identity:176/674 - (26%)
Similarity:280/674 - (41%) Gaps:170/674 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSLLTLNCHALGNPEPNITWYRNGTVDWTRGYGSLKRNRWT----------LTMEDLVPGDCG-N 171
            |..:||:|:..|:|.|.:.|.       .:|..|:..::.|          ||:.::...|.| .
Zfish   223 GGNVTLSCNGSGSPVPEVDWA-------VKGLHSINTHQSTVYLPNTHSINLTLVNVSRDDNGFV 280

  Fly   172 YTCKVCNSLGCIRHDTQVIV-----------SDRVNHKPILMT--GPLNLTLVVNSTGSMHCKYL 223
            .||...|.:|......|:.|           .:|.:|..|..|  |..:.||        |    
Zfish   281 LTCISENVVGMNNVSLQLSVLFPPVILKLDEPERRHHTCIEFTVRGFPHPTL--------H---- 333

  Fly   224 SDLTSKKAWIFVPCHGMTNCSNNRSIIAED---------KDQLD----FVNVRMEQEGWYTCVES 275
                    |.:          ..|.|:..:         ||.|:    |.|......|.||.|.:
Zfish   334 --------WFY----------KGREILQSEYIRMEMDYYKDYLEGCLTFENPTHYDNGNYTLVAT 380

  Fly   276 NSLGQSNSTAYLRVVRSLHVLEAGVA--------SGSLHSTSFVYIFVFG--GLIFIFMTTLFVF 330
            ||||..:.|.:...:....:.:.|:.        .|.....||......|  |...:|:..:||.
Zfish   381 NSLGSVSKTVFGHFLDPPFMEDDGIMEYTPPPEDEGKRPEDSFGMSIAVGLAGFGCVFLIVIFVL 445

  Fly   331 YAIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSM----DTMIMP--------VVRIQK 383
            ......:::..:|..:..:            .|..||:..:    ..::.|        .|.|..
Zfish   446 INKYSRRNKFGIKGPVAVI------------SGEEDSASPLHHVNHGIVTPCSLDAGPDAVVIGM 498

  Fly   384 QRTTVLQNG---------NEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNN-- 437
            .|..|::|.         |:|..:.::         :.|..:||...|||||||:|.:||..|  
Zfish   499 SRIPVIENPQYFRHGHNCNKPTTYVQH---------IKRRDIVLKRELGEGAFGKVFLAECYNLS 554

  Fly   438 -----AIVAVKMVKEGHTDDDIAS---LVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAP 494
                 .:||||.:|    |..:.:   ..||.|::..: :|.:|:...|.|....||.::.||..
Zfish   555 PTKDKMLVAVKTLK----DPTLTARKDFQREAELLTNL-QHEHIVKFYGVCVDGDPLIMVFEYMK 614

  Fly   495 HGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITE------------KDLIKFAHQIARGMDYL 547
            ||:|..||   |..|             |.|.::.:            ..::..|.|||.||.||
Zfish   615 HGDLNKFL---RAHG-------------PDAMILVDGQPMQSNGELGLSQMLHIATQIAAGMVYL 663

  Fly   548 ASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDS 612
            :|:..:|||||.||.||.:..::||.|||::|||.|:||||...:..|||:||.|||:..:.:.:
Zfish   664 SSQHFVHRDLATRNCLVGNGLLVKIGDFGMSRDIYSSDYYRVGGHTMLPIRWMPPESIMYRKFST 728

  Fly   613 KSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADD 677
            :|||||:|:::|||.|||:||: ..:|..|:...:..|:.:::|..|...:|.||..||......
Zfish   729 ESDVWSFGVIMWEIFTYGKQPW-FHLSNNEVIECITQGRVLDRPRLCPKEVYDLMLGCWQREPQQ 792

  Fly   678 RPPFTEIVEYMDKLLQTKEDYLDV 701
            |....:|.:.:..|.:....|||:
Zfish   793 RLNIKDIQKVLYALGKATPVYLDI 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 20/83 (24%)
Ig strand B 121..125 CDD:409353 2/3 (67%)
Ig strand C 134..138 CDD:409353 0/3 (0%)
Ig strand E 157..161 CDD:409353 2/13 (15%)
Ig strand F 171..176 CDD:409353 2/4 (50%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 200..289 CDD:472250 23/103 (22%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/7 (29%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 105/309 (34%)
ntrk3bXP_002662799.4 LRR_8 103..159 CDD:404697
leucine-rich repeat 105..128 CDD:275378
leucine-rich repeat 129..151 CDD:275378
LRRCT_2 164..207 CDD:465313
ig 213..298 CDD:395002 19/81 (23%)
Ig strand B 226..230 CDD:409405 2/3 (67%)
Ig strand C 239..249 CDD:409405 2/16 (13%)
Ig strand E 265..269 CDD:409405 1/3 (33%)
Ig strand F 279..285 CDD:409405 2/5 (40%)
Ig strand G 293..296 CDD:409405 0/2 (0%)
IgI_TrKABC_d5 303..395 CDD:409360 25/121 (21%)
Ig strand A 304..310 CDD:409360 0/5 (0%)
Ig strand A' 312..315 CDD:409360 0/2 (0%)
Ig strand B 318..326 CDD:409360 2/7 (29%)
Ig strand C 329..336 CDD:409360 4/26 (15%)
Ig strand C' 339..342 CDD:409360 1/2 (50%)
Ig strand D 347..353 CDD:409360 0/5 (0%)
Ig strand E 357..365 CDD:409360 1/7 (14%)
Ig strand F 373..381 CDD:409360 4/7 (57%)
Ig strand G 384..392 CDD:409360 2/7 (29%)
PTKc_TrkC 525..811 CDD:270676 106/316 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.