DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Pdgfrl

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_081116.3 Gene:Pdgfrl / 68797 MGIID:1916047 Length:375 Species:Mus musculus


Alignment Length:441 Identity:78/441 - (17%)
Similarity:127/441 - (28%) Gaps:187/441 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EMIKDHLGARS-QNKTPAITNNANQSSTSSADLDDGAADDDDNKADLPVNVSSKPYWRNPKKMSF 111
            |.::|..|..| :||.|                    .:..:|:.. |.|..:||  :.||....
Mouse    14 EALEDVGGQHSPKNKRP--------------------KEQGENRIK-PTNKKAKP--KIPKVKDR 55

  Fly   112 LQTRPSGSLLTLNCHALGN-----PEPNITWYRNGT---------VDWT-RGY-GSLKRNRWT-- 158
            ..|..:....::...|:||     |...::.....|         |:|: ..| .:.|.:|.|  
Mouse    56 DSTDSTAKSQSIMMQAMGNGRFQRPAATVSLLAGQTLELRCKGSKVEWSYPAYLDTFKDSRLTVK 120

  Fly   159 -------LTMEDLVPGDCGNYTC--KVCNSLGCIRHDTQVIVSDRVNHKPILMTGPLNLTLVVNS 214
                   ||:.:....|.|.::|  ::||...|.|.:.:                          
Mouse   121 QSERYGQLTLVNSTAADTGEFSCWEQLCNGYICRRDEAK-------------------------- 159

  Fly   215 TGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNNRSIIAEDKDQLDFVNVRMEQEGWYTCVESNSLG 279
            |||.:..:     ::|..:|||                .....|.|.:..:::....|       
Mouse   160 TGSTYIFF-----TEKGELFVP----------------SPSYFDVVYLNPDRQAVVPC------- 196

  Fly   280 QSNSTAYLRVVRSLHVLEAGVASGSLH-----------STSFVYIFVFGGLIFIFMTTLFVFYAI 333
                    ||.       |..|..:||           .|..||....|   |:::..       
Mouse   197 --------RVT-------APSAKVTLHREFPAKEIPANGTDIVYDMKRG---FVYLQP------- 236

  Fly   334 RKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDTMIMPV-VRIQKQRTTVLQNGNE--- 394
                            |...:.|:..|.|.||.|..|:...::.| |......||:|.:.|:   
Mouse   237 ----------------HSDHQGVVYCKAEAGGKSQISVKYQLLYVEVPSGPPSTTILASSNKVRG 285

  Fly   395 ------------------------PAPFNEYEFPLDSNWELPRSHLVLGAT 421
                                    |...:|....:...|.|  .|..||.|
Mouse   286 GDDISVLCTVLGEPDVEVEFRWLFPGQKDERPVTIQDTWRL--IHRGLGHT 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 24/116 (21%)
Ig strand B 121..125 CDD:409353 0/3 (0%)
Ig strand C 134..138 CDD:409353 0/3 (0%)
Ig strand E 157..161 CDD:409353 2/12 (17%)
Ig strand F 171..176 CDD:409353 1/6 (17%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 10/88 (11%)
Ig strand B 216..220 CDD:409353 2/3 (67%)
Ig strand C 229..233 CDD:409353 1/3 (33%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 1/4 (25%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 6/18 (33%)
PdgfrlNP_081116.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..63 13/65 (20%)
IG_like 83..>143 CDD:214653 11/59 (19%)
Ig strand B 92..96 CDD:409448 0/3 (0%)
Ig strand C 100..104 CDD:409448 1/3 (33%)
Ig strand F 140..144 CDD:409448 0/3 (0%)
Ig 278..372 CDD:472250 9/59 (15%)
Ig strand B 289..293 CDD:409353 0/3 (0%)
Ig strand C 304..308 CDD:409353 0/3 (0%)
Ig strand E 340..344 CDD:409353
Ig strand F 354..359 CDD:409353
Ig strand G 367..370 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.