DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and SRC

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_047296363.1 Gene:SRC / 6714 HGNCID:11283 Length:562 Species:Homo sapiens


Alignment Length:197 Identity:41/197 - (20%)
Similarity:73/197 - (37%) Gaps:49/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VCGFLSDRL-----GRK--------PVYLGCLLMITIGHILLTFSMYLSWMTINATLAAMGFFCG 183
            |||.|...:     |:|        .||:|...:.|:.|::        |...:.:.|.......
Human  1037 VCGSLRPPIVIHSSGKKYGFSLRAIRVYMGDSDVYTVHHVV--------WSVEDGSPAQEAGLRA 1093

  Fly   184 GYMVTNF-------VILTEAFELPKSRLLVVSLNGWSVSMAVTALAASYTLNWYAYHTIFAIVGA 241
            |.::|:.       ::..:..||       :..:|..:|:..|||.          :|...:..|
Human  1094 GDLITHINGESVLGLVHMDVVEL-------LLKSGNKISLRTTALE----------NTSIKVGPA 1141

  Fly   242 --CIAIISLATCSESCRWLSANGLQNDA-KKIALQITLLNNNRDIEEDDISILSWHEILGFSAPT 303
              .:|...:|..|:..|.......:... |||:.|.::|:.:|.........||..|.|. .:||
Human  1142 RKNVAKGRMARRSKRSRRRETQDRRKSLFKKISKQTSVLHTSRSFSSGLHHSLSSSESLP-GSPT 1205

  Fly   304 HT 305
            |:
Human  1206 HS 1207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 15/78 (19%)
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353 2/3 (67%)
Ig strand E 157..161 CDD:409353 1/3 (33%)
Ig strand F 171..176 CDD:409353 0/4 (0%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 17/91 (19%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864
SRCXP_047296363.1 SH3_Src 114..169 CDD:212941
SH2_Src_Src 173..273 CDD:198228
PTKc_Src 286..562 CDD:270656
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.