DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and STYK1

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_060893.2 Gene:STYK1 / 55359 HGNCID:18889 Length:422 Species:Homo sapiens


Alignment Length:373 Identity:102/373 - (27%)
Similarity:176/373 - (47%) Gaps:64/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 IQKQRTTVLQNGNE---PAPFNEYEFPLDSNWE--------LPRSHL----VLGAT--------- 421
            |::|||...::|.:   |.|     .|.|.:||        ||....    .||||         
Human    49 IREQRTQQQRSGPQGIAPVP-----PPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQV 108

  Fly   422 ----LGE-------GAFGRVVMAEVNNA------IVAVKMVKEGHTDDDIASLVREMEVMKIIGR 469
                |.|       |:.|.:..|.:|..      .|.:|.:||.....::...:..::..:.:|:
Human   109 PREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGK 173

  Fly   470 HINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRD-QDRDSSQPPPSPPAHVITEKDL 533
            |.|::.|.|||::..|||:::|....|:|..||:..|   || ...|..       .:.:|||.:
Human   174 HKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCR---RDVMTMDGL-------LYDLTEKQV 228

  Fly   534 IKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRK--NTNGRLP 596
            .....|:...:::|..:...|.|:||||:|:..|...|:...|||.::    |.|.  ::...:|
Human   229 YHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEV----YTRGAISSTQTIP 289

  Fly   597 IKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSM 661
            :||:|||.|..:....::||||:||||:|::|.|..|||.: ....:..:|...:.|::|:.|:.
Human   290 LKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEV-PPTSILEHLQRRKIMKRPSSCTH 353

  Fly   662 NIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYLDVDIANLDTP 709
            .:|.:|:.||.:...|||...|:...::..::|.:|...:.:..|..|
Human   354 TMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 91/328 (28%)
STYKc 416..688 CDD:214568 85/304 (28%)
STYK1NP_060893.2 Pkinase_Tyr 117..380 CDD:285015 79/277 (29%)
PKc_like 118..381 CDD:304357 79/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.