DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and fgfr1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_012814428.1 Gene:fgfr1 / 548648 XenbaseID:XB-GENE-1018554 Length:816 Species:Xenopus tropicalis


Alignment Length:741 Identity:283/741 - (38%)
Similarity:409/741 - (55%) Gaps:83/741 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EGRRQMANSQEMIKDHLGARSQNKTPAITN------------NANQSSTSSADLDDGAADDDDNK 90
            |..|.....:|:...:.|.........:||            |.:.:..|:.|.||   |||::.
 Frog    74 ETNRTRITGEEIQISNAGPEDNGVYTCVTNGPSGTYTVLFSVNVSDALPSAEDDDD---DDDNSS 135

  Fly    91 ADLPVNVSSK---PYWRNPKKM-SFLQTRPSGSLLTLNCHALGNPEPNITWYRNG---TVDWTRG 148
            ::...:.:||   |:|.:|:|| ..|...|:...:...|.|.|.|:||:.|.:||   ..|...|
 Frog   136 SEEKASENSKPNRPFWSHPEKMEKKLHAVPAAKTVKFRCPANGTPQPNLRWLKNGKEFRQDQRIG 200

  Fly   149 YGSLKRNRWTLTMEDLVPGDCGNYTCKVCNSLGCIRHDTQVIVSDRVNHKPILMTG-PLNLTLVV 212
            ...::...|:|.|:.:||.|.|||||.|.|..|.:.|..|:.|.:|..|:|||..| |.|.:::|
 Frog   201 GYKVRSQTWSLIMDSVVPSDKGNYTCIVENKYGTLNHTYQLDVVERSPHRPILQAGLPANTSVIV 265

  Fly   213 NSTGSMHCKYLSDLTSKKAWI-FVPCHGMTNCSN---------NRSIIAEDKDQLDFVNVRMEQE 267
            .||....||..||......|: .:..:|....|:         :..|.:.|.:.|...||...:.
 Frog   266 GSTAEFFCKVYSDPQPHIQWLRHIEINGSRVASDGFPYVEILKHSGINSSDAEVLTLYNVTEAES 330

  Fly   268 GWYTCVESNSLGQSNSTAYLRVVRSLHVLE----AGVASGSLHSTSFVYIFVFGGLIFI--FMTT 326
            |.|.|..||.:|::|.:|:|.|.|.:..:|    |.:|| .|.....:|.   .|..|:  .:.|
 Frog   331 GEYICKVSNYIGEANQSAWLTVTRPVTKVEDDKPAPLAS-PLQLEIIIYC---TGAAFVSAMVIT 391

  Fly   327 LFVFYAIRKMKH---EKVLKQRIETVHQWTKKVIIFKP-EGGGDSSGSMDTMIMPVVRIQKQRTT 387
            :.:|    ||||   :.....:: .||:..|.:.:.:. ...|||:.||.:.::.|      |.:
 Frog   392 IIIF----KMKHPSKKSDFNSQL-AVHKLAKSIPLRRQVTVSGDSNSSMHSGVILV------RPS 445

  Fly   388 VLQNGNEP--APFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEV-------NNAI--VA 441
            .|.:...|  :..:|||.|.|..||:.|..|:||..||||.||:|||||.       .|.:  ||
 Frog   446 RLSSSGTPMLSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVA 510

  Fly   442 VKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNR 506
            |||:|...::.|::.|:.|||:||:||:|.|||||||.|:|:||||||||||..|||:::|...|
 Frog   511 VKMLKSDASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR 575

  Fly   507 PFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLK 571
            |.|.:.    ...|...|..:::.|||:..|:|:||||:||||::|||||||||||||::|.|:|
 Frog   576 PPGMEY----CYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMK 636

  Fly   572 IADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPT 636
            ||||||||||...|||:|.||||||:||||||:|.::.|..:|||||:|:|||||.|.|..|||.
 Frog   637 IADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPG 701

  Fly   637 IMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKL--LQTKEDYL 699
            : ..|||:..|..|.||:||..|:..:|::|:.|||.....||.|.::||.:|::  |.:.::||
 Frog   702 V-PMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRILALSSNQEYL 765

  Fly   700 DVDI-ANL------DTPPSTSDEEED 718
            |:.: .|.      ||..||....||
 Frog   766 DLSMPVNQYSPCFPDTRSSTCSSGED 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 34/93 (37%)
Ig strand B 121..125 CDD:409353 0/3 (0%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 2/3 (67%)
Ig strand F 171..176 CDD:409353 4/4 (100%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 29/99 (29%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 1/2 (50%)
Protein Kinases, catalytic domain 404..692 CDD:473864 158/298 (53%)
fgfr1XP_012814428.1 Ig 25..117 CDD:472250 6/42 (14%)
Ig strand B 50..54 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 83..87 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 0/4 (0%)
Ig strand G 110..113 CDD:409353 0/2 (0%)
IgI_2_FGFR 149..243 CDD:409443 34/93 (37%)
Ig strand A 149..152 CDD:409443 1/2 (50%)
Ig strand A' 160..165 CDD:409443 1/4 (25%)
Ig strand B 169..177 CDD:409443 1/7 (14%)
Ig strand C 183..188 CDD:409443 2/4 (50%)
Ig strand C' 191..193 CDD:409443 0/1 (0%)
Ig strand D 202..205 CDD:409443 0/2 (0%)
Ig strand E 209..214 CDD:409443 2/4 (50%)
Ig strand F 223..230 CDD:409443 5/6 (83%)
Ig strand G 233..243 CDD:409443 3/9 (33%)
Ig 251..352 CDD:472250 30/100 (30%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 282..286 CDD:409353 0/3 (0%)
Ig strand E 318..322 CDD:409353 1/3 (33%)
Ig strand F 332..337 CDD:409353 2/4 (50%)
Ig strand G 345..348 CDD:409353 1/2 (50%)
PTKc_FGFR1 462..763 CDD:270678 160/305 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.