DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and FGFRL1

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:298 Identity:84/298 - (28%)
Similarity:130/298 - (43%) Gaps:33/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GARSQNKTPAITNNANQSSTS-SADLDDGAADDDDNKADLPVNVS-SKPYWRNPKKM-SFLQTRP 116
            |:.|.|.|..:.::.:....| ..|...|..:|       |.:.. ::|.:..|.|| ..:..||
Human   129 GSLSVNYTLVVLDDISPGKESLGPDSSSGGQED-------PASQQWARPRFTQPSKMRRRVIARP 186

  Fly   117 SGSLLTLNCHALGNPEPNITWYRNGTVDWTRGYGSLKRNRWTLTMEDLVPGDCGNYTCKVCNSLG 181
            .||.:.|.|.|.|:|.|:|||.::............::.:|||::::|.|.|.|.|||:|.|..|
Human   187 VGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAG 251

  Fly   182 CIRHDTQVIVSDRVNHKPILM-TGPLNLTLVVNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSN 245
            .|....:|.|..|...||:|. |.|:|.|:....|.|..||..||:.....|:....:|.....|
Human   252 AINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHN 316

  Fly   246 NRSIIAEDK------------------DQLDFVNVRMEQEGWYTCVESNSLGQSNSTAYLRVVRS 292
            :...:...|                  ::|.....|.:..|.|.|:.:|::|.|..:|:|.|:..
Human   317 STIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPD 381

  Fly   293 LHVLEAGVASGSLHSTSFVYIFVFG---GLIFIFMTTL 327
            .......|||.| .:||..:..|.|   |.:||..|.|
Human   382 PKPPGPPVASSS-SATSLPWPVVIGIPAGAVFILGTLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845 28/78 (36%)
IG_like 113..191 CDD:214653 28/77 (36%)
IG_like 205..289 CDD:214653 23/101 (23%)
PKc_like 404..692 CDD:304357
STYKc 416..688 CDD:214568
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352 4/9 (44%)
Ig2_FGFRL1-like 180..261 CDD:143264 28/80 (35%)
Ig 284..378 CDD:325142 20/93 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.