DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and PDGFRL

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001359002.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:80 Identity:25/80 - (31%)
Similarity:32/80 - (40%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SGSLLTLNCHALGNP--EPNITWYRNGTVD---------WT---RGYGSLKR-NRWTLTMEDLVP 166
            ||..:::.|..||.|  |...||...|..|         |.   ||.|...| ::..:|:||...
Human   285 SGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFET 349

  Fly   167 GDCGNYTCKVCNSLG 181
            .|.|.|.|...|..|
Human   350 IDAGYYICTAQNLQG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845 25/80 (31%)
IG_like 113..191 CDD:214653 25/80 (31%)
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357
STYKc 416..688 CDD:214568
PDGFRLNP_001359002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653
Ig 293..372 CDD:386229 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.