DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and PDGFRL

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_006198.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:80 Identity:25/80 - (31%)
Similarity:32/80 - (40%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SGSLLTLNCHALGNP--EPNITWYRNGTVD---------WT---RGYGSLKR-NRWTLTMEDLVP 166
            ||..:::.|..||.|  |...||...|..|         |.   ||.|...| ::..:|:||...
Human   285 SGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFET 349

  Fly   167 GDCGNYTCKVCNSLG 181
            .|.|.|.|...|..|
Human   350 IDAGYYICTAQNLQG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 25/80 (31%)
Ig strand B 121..125 CDD:409353 0/3 (0%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 0/3 (0%)
Ig strand F 171..176 CDD:409353 2/4 (50%)
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864
PDGFRLNP_006198.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653
Ig 278..372 CDD:472250 25/80 (31%)
Ig strand B 289..293 CDD:409404 0/3 (0%)
Ig strand C 304..308 CDD:409404 1/3 (33%)
Ig strand E 340..344 CDD:409404 0/3 (0%)
Ig strand F 354..359 CDD:409404 2/4 (50%)
Ig strand G 367..370 CDD:409404
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.