DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and NTRK1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_002520.2 Gene:NTRK1 / 4914 HGNCID:8031 Length:796 Species:Homo sapiens


Alignment Length:735 Identity:187/735 - (25%)
Similarity:281/735 - (38%) Gaps:225/735 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QVEGR---------RQMANSQEMIKDHLGARSQNKTPA-ITNNANQSS-TSSADLDDGAADDDDN 89
            |||||         .::..|..::|.. |..|...|.| :|::.|:.: |..|:.|.|.|:    
Human   216 QVEGRGLEQAGWILTELEQSATVMKSG-GLPSLGLTLANVTSDLNRKNVTCWAENDVGRAE---- 275

  Fly    90 KADLPVNVS-----------SKPYWRNPKKMSFLQTRPSGSLLTLNCHALGNPEPNITWYRNGTV 143
             ..:.||||           ...:|..|..:.                  |.|.|::.|..||:|
Human   276 -VSVQVNVSFPASVQLHTAVEMHHWCIPFSVD------------------GQPAPSLRWLFNGSV 321

  Fly   144 DWTRGYGSLKRNRWTLTMEDLVPGDCGNYTCKVCNSLGCIRHDTQVIVSDRVNHKPILMTGPLNL 208
                    |....:..| |.|.|  ..|.|.:    .||:|                     ||.
Human   322 --------LNETSFIFT-EFLEP--AANETVR----HGCLR---------------------LNQ 350

  Fly   209 TLVVNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNNRSIIAEDKDQLDFVNVRMEQEGWYTCV 273
            ...||:                                                     |.||.:
Human   351 PTHVNN-----------------------------------------------------GNYTLL 362

  Fly   274 ESNSLGQSNST---AYL----------RVVRSLHVLEAGVASG----SLHSTSFVYIFVFGGLIF 321
            .:|..||::::   |::          .:..|...::....||    ....|.|......|..:|
Human   363 AANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVF 427

  Fly   322 --IFMTTLFVFYAIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGG-------------------G 365
              :|::||.:           ||.:..........:..:..||.|                   |
Human   428 ACLFLSTLLL-----------VLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEG 481

  Fly   366 DSSGSMDTMIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRV 430
            ..||....:|                 ..|..|::     .....:.|..:||...|||||||:|
Human   482 KGSGLQGHII-----------------ENPQYFSD-----ACVHHIKRRDIVLKWELGEGAFGKV 524

  Fly   431 VMAEVNN-------AIVAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYV 488
            .:||.:|       .:||||.:||. ::.......||.|::.:: :|.:|:...|.|::..||.:
Human   525 FLAECHNLLPEQDKMLVAVKALKEA-SESARQDFQREAELLTML-QHQHIVRFFGVCTEGRPLLM 587

  Fly   489 IVEYAPHGNLKDFLYKNRPFGRDQD--RDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRR 551
            :.||..||:|..||   |..|.|..  .......|.|    :....|:..|.|:|.||.|||...
Human   588 VFEYMRHGDLNRFL---RSHGPDAKLLAGGEDVAPGP----LGLGQLLAVASQVAAGMVYLAGLH 645

  Fly   552 CIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDV 616
            .:|||||.||.||....|:||.|||::|||.||||||......|||:||.|||:..:.:.::|||
Human   646 FVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDV 710

  Fly   617 WSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPF 681
            ||:|::||||.|||:||:..:.:.|.: ..:..|:.:|:|..|...:|.:||.||......|...
Human   711 WSFGVVLWEIFTYGKQPWYQLSNTEAI-DCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSI 774

  Fly   682 TEIVEYMDKLLQTKEDYLDV 701
            .::...:..|.|....||||
Human   775 KDVHARLQALAQAPPVYLDV 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 19/89 (21%)
Ig strand B 121..125 CDD:409353 0/3 (0%)
Ig strand C 134..138 CDD:409353 0/3 (0%)
Ig strand E 157..161 CDD:409353 0/3 (0%)
Ig strand F 171..176 CDD:409353 2/4 (50%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 11/101 (11%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/5 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 108/296 (36%)
NTRK1NP_002520.2 leucine-rich repeat 68..92 CDD:275378
LRR 1 90..113
LRR_8 92..150 CDD:404697
leucine-rich repeat 93..116 CDD:275378
LRR 2 116..137
leucine-rich repeat 117..139 CDD:275378
leucine-rich repeat 140..152 CDD:275378
LRRCT_2 151..192 CDD:465313
Ig_TrkABC_d4 195..282 CDD:409361 19/71 (27%)
Ig strand A 195..201 CDD:409361
Ig strand B 210..219 CDD:409361 2/2 (100%)
Ig strand C 222..229 CDD:409361 0/6 (0%)
Ig strand C' 231..233 CDD:409361 0/1 (0%)
Ig strand D 236..243 CDD:409361 1/7 (14%)
Ig strand E 246..255 CDD:409361 3/8 (38%)
Ig strand F 262..269 CDD:409361 2/6 (33%)
Ig strand G 272..279 CDD:409361 2/11 (18%)
IgI_TrKABC_d5 285..379 CDD:409360 30/200 (15%)
Ig strand A 285..291 CDD:409360 0/5 (0%)
Ig strand A' 293..296 CDD:409360 0/2 (0%)
Ig strand B 299..307 CDD:409360 2/25 (8%)
Ig strand C 310..317 CDD:409360 2/6 (33%)
Ig strand C' 320..323 CDD:409360 1/10 (10%)
Ig strand D 328..334 CDD:409360 2/6 (33%)
Ig strand E 341..349 CDD:409360 3/32 (9%)
Ig strand F 357..365 CDD:409360 3/7 (43%)
Ig strand G 368..376 CDD:409360 2/7 (29%)
Interaction with SQSTM1. /evidence=ECO:0000250 469..490 3/20 (15%)
PTKc_TrkA 504..783 CDD:270674 108/288 (38%)
DXXLL. /evidence=ECO:0000269|PubMed:26446845 537..541 0/3 (0%)
DXXLL. /evidence=ECO:0000269|PubMed:26446845 607..611 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.