DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and slpr

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:442 Identity:119/442 - (26%)
Similarity:176/442 - (39%) Gaps:116/442 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VRSLHVLEAGVASGSLHSTSFVYIFVFGGLIFIFMTTLFVFYA-------IRKMKHEKVLKQRIE 347
            :..|..:|..|..|||                  .|.|:.:.|       :|:.:...||....|
  Fly    32 IPDLEQVETQVGDGSL------------------WTALYDYDAQGEDELTLRRGEIVVVLSTDSE 78

  Fly   348 T---VHQWTKKVIIFKPEGGGDSSGSMDTMIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPLDSN- 408
            .   |..||.|:        ||..|..                       |..|...|.||..| 
  Fly    79 VSGDVGWWTGKI--------GDKVGVF-----------------------PKDFVTDEDPLQLNV 112

  Fly   409 ---------WELPRSHLVLGATLGEGAFGRVVMAEVNNAIVAVKMVKEGHTDD-----DIASLVR 459
                     .|:..:.|.:...:|.|.|.:|.....:...||:|:..:...||     |  ::::
  Fly   113 SSAIGDIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRD--NVLQ 175

  Fly   460 EMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPP 524
            |.::...: :|.||..|.|.| .|..|.:::|||..|:|...|             :.:.||.. 
  Fly   176 EAKLFWAL-KHENIAALRGVC-LNTKLCLVMEYARGGSLNRIL-------------AGKIPPDV- 224

  Fly   525 AHVITEKDLIKFAHQIARGMDYL---ASRRCIHRDLAARNVLVSD--------DYVLKIADFGLA 578
                    |:.:|.||||||:||   |....|||||.:.|||:.:        ...|||.|||||
  Fly   225 --------LVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLA 281

  Fly   579 RDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEEL 643
            |::.:|.  |.:..|  ...||.||.:....|...|||||||:||||::| |:.||.........
  Fly   282 REMYNTQ--RMSAAG--TYAWMPPEVISVSTYSKFSDVWSYGVLLWELIT-GETPYKGFDPLSVA 341

  Fly   644 YTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTK 695
            |...::...:..|..|......||:.||..:...||.|.||::.::.:..:|
  Fly   342 YGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 95/313 (30%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 17/105 (16%)
STKc_MLK 134..389 CDD:270963 90/285 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.