DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Ret

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:433 Identity:150/433 - (34%)
Similarity:230/433 - (53%) Gaps:59/433 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 SFVYIFVFGGLIFIFMTTLFVFYAIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDT 373
            |.::..:...|:|:.: .|.:..|.|||...::.||.:.|.   :|:.:   ||.||.     |.
  Fly   694 SCMFFVITCPLLFVLL-LLCLLIAQRKMLQRRLGKQSMTTS---SKQAL---PESGGG-----DF 746

  Fly   374 MIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPL-DSNWELPRSHLVLGATLGEGAFGRVVMAEVNN 437
            .:||           ||:|        :.|.. |:.||.||..|.|...||||.||:|:......
  Fly   747 ALMP-----------LQSG--------FRFESGDAKWEFPREKLQLDTVLGEGEFGQVLKGFATE 792

  Fly   438 -------AIVAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPH 495
                   ..|||||:|:|....:..:|:.|.::::.:. |.|:|.|||.|:.:....:|:|||.:
  Fly   793 IAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVS-HPNVIKLLGACTSSEAPLLIIEYARY 856

  Fly   496 GNLKDFLYKNRPF---GRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDL 557
            |:|:.:|..:|..   |.| ..|..:|        :..|.::.||.||.:||.||:..:.:||||
  Fly   857 GSLRSYLRLSRKIECAGVD-FADGVEP--------VNVKMVLTFAWQICKGMAYLSELKLVHRDL 912

  Fly   558 AARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGIL 622
            ||||||::|..:.||:||||.||:...|.|.|.:..|:|:||||||||.:..|.|||||||:|:|
  Fly   913 AARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVL 977

  Fly   623 LWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEY 687
            .||::|.|..|||.| :.:.|::.|.:|.||::|..||..:|.::|.||....:.||.|..:...
  Fly   978 CWELITLGASPYPGI-APQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASE 1041

  Fly   688 MDKLLQTKEDYLDVDIANLDTPPSTSDE------EEDETDNLQ 724
            .:|||.....|:|::...:..|....|:      |..|.::||
  Fly  1042 FEKLLGNNAKYIDLETNAVSNPLYCGDDSALITTELGEPESLQ 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 117/298 (39%)
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 114/289 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.