DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Sdr

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster


Alignment Length:315 Identity:57/315 - (18%)
Similarity:97/315 - (30%) Gaps:141/315 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TVDW-------TRGYGSLKRNR-------------------------WTLTMEDLVP-------- 166
            ||||       ||.:.|||.||                         |.:....|.|        
  Fly   166 TVDWIYLMGNATRQHFSLKHNRPQSQCPLCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDC 230

  Fly   167 ------------GDC-------GNYT--CKVC----NSLGCIRHDTQVIVSDRVN------HKPI 200
                        |.|       |.|:  |.:|    ..:||:   .|.:.|..:|      |:..
  Fly   231 PIACGLNGCDSAGKCCDHNCVTGCYSQNCSLCANYQGRMGCV---NQCVASYELNKRRCIGHREC 292

  Fly   201 LMTG--------------PLNLTLVVNSTGSMHCKYLSDLTSKKAWIFVPCHG------------ 239
            ...|              |.|...::.:.|.:||:             |.|:|            
  Fly   293 RELGRIPLIRGYQCVKKCPGNQKEILVAKGIIHCQ-------------VECNGDFHVKSAADLEV 344

  Fly   240 MTNC-SNNRSIIAEDKDQLDFVNVRMEQEGWYTCVESNSLGQSNSTAYLRVVRSLHVL------- 296
            :.:| :.|.|:      .::..|::   |.....:|:........|.||:|:.|..::       
  Fly   345 LQDCVTINGSL------TIELTNIK---EKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQN 400

  Fly   297 ----------EAGVASGSLHSTSFVYIFVFGGLIFIFMTTLFVFYAIRKMKHEKV 341
                      |...|...:::....:|:....|:.|...||| |:...::.:||:
  Fly   401 LDAIRGDKLVENKYALYVVNNYHLEHIWPPNHLVIIQRGTLF-FHLNPRLCYEKI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845 23/113 (20%)
IG_like 113..191 CDD:214653 23/113 (20%)
IG_like 205..289 CDD:214653 17/96 (18%)
PKc_like 404..692 CDD:304357
STYKc 416..688 CDD:214568
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 4/6 (67%)
Furin-like 209..332 CDD:279142 23/138 (17%)
Recep_L_domain 347..461 CDD:279382 22/118 (19%)
FN3 491..578 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.