DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and yes1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001013288.2 Gene:yes1 / 407620 ZFINID:ZDB-GENE-050126-1 Length:546 Species:Danio rerio


Alignment Length:358 Identity:118/358 - (32%)
Similarity:167/358 - (46%) Gaps:73/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 TMIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNN 437
            |.:.|.|:.|.|...                  ...||:||..|.|...||:|.||.|.|...|.
Zfish   255 TTVCPTVKPQTQGLA------------------KDAWEIPRESLRLELKLGQGCFGEVWMGTWNG 301

  Fly   438 AI-VAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDF 501
            .. ||:|.:|.|....:  :.::|.::||.: ||..::.|....|:. |:|::.||...|:|.||
Zfish   302 TTKVAIKTLKPGTMSPE--AFLQEAQIMKKL-RHDKLVPLYAVVSEE-PIYIVTEYMGKGSLLDF 362

  Fly   502 L------YKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAAR 560
            |      |...|                        .|:..|.|||.||.::.....|||||.|.
Zfish   363 LKEGEGKYLKLP------------------------QLVDMAAQIADGMAFIERMNYIHRDLRAA 403

  Fly   561 NVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWE 625
            |:||.|:.|.|||||||||.|:..:|..:. ..:.||||.|||:.....:..||||||:||||.|
Zfish   404 NILVGDNLVCKIADFGLARLIEDNEYTARQ-GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTE 467

  Fly   626 IMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDK 690
            ::|.|:.|||.:::.|.| ..:..|.||..|..|..:::.:||.||....|:||.|    ||:..
Zfish   468 LVTKGRVPYPGMVNREVL-EQVERGYRMPCPQGCPESLHEMMRLCWKKEPDERPTF----EYIQS 527

  Fly   691 LLQTKEDYLDVDIANLDTPPSTSDEEEDETDNL 723
            .|   |||.           :.::.:....|||
Zfish   528 FL---EDYF-----------TATEPQYQPGDNL 546

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 106/294 (36%)
yes1NP_001013288.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
SH3_Yes 97..154 CDD:212940