DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Tak1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster


Alignment Length:295 Identity:92/295 - (31%)
Similarity:138/295 - (46%) Gaps:35/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 SHLVLGATLGEGAFGRVVMAEVNNAIVAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLG 478
            |.:.|...:|.|::|.|..|...:.:||||.........||...|:::..:|    |.|||.|.|
  Fly    17 SEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVK----HPNIIALHG 77

  Fly   479 CCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARG 543
            ..|.....|:|:|:|..|:|.:||:            ....|....||.::      :|.|.|.|
  Fly    78 ISSYQQATYLIMEFAEGGSLHNFLH------------GKVKPAYSLAHAMS------WARQCAEG 124

  Fly   544 MDYL---ASRRCIHRDLAARNVLVSD-DYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPES 604
            :.||   ..:..||||:...|:|::: ...|||.|||...| :||    ..||.|....|||||.
  Fly   125 LAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVAD-KST----MMTNNRGSAAWMAPEV 184

  Fly   605 LQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQ 669
            .:...|..|.|::|:.|:|||::: .:||:..|.:|..:...:..|:|......|...|..||..
  Fly   185 FEGSKYTEKCDIFSWAIVLWEVLS-RKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTA 248

  Fly   670 CWHFNADDRPPFTEIVEYMDKLLQTKEDYLDVDIA 704
            ||....:|||....||..|.:::   :||...|.|
  Fly   249 CWKTVPEDRPSMQYIVGVMHEIV---KDYTGADKA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 88/281 (31%)
Tak1NP_524080.1 STKc_TAK1 25..275 CDD:270960 87/280 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.