DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Egfr

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster


Alignment Length:786 Identity:181/786 - (23%)
Similarity:296/786 - (37%) Gaps:249/786 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RNPKKMSFLQTRPSGSLLTLN----CHALGNPEPNITW----------------------YRNGT 142
            ||.|::|      |||::..:    |:.     .||.|                      .:|||
  Fly   518 RNLKQIS------SGSVVIQHNRDLCYV-----SNIRWPAIQKEPEQKVWVNENLRADLCEKNGT 571

  Fly   143 V-------DWTRGYGSLKRNRWTLTMEDL-----VPGDCG---------NYTCKV-------CNS 179
            :       |...|.|:.:    .||.::.     ...|||         |.|||:       ||.
  Fly   572 ICSDQCNEDGCWGAGTDQ----CLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNG 632

  Fly   180 LG------CIR-HDTQVIVSD----RVNHKPIL---------MTGP-----------LNLTLVVN 213
            .|      |:. .|.|..||:    :.|.:.:.         .|||           .||.::.|
  Fly   633 AGADHCQECVHVRDGQHCVSECPKNKYNDRGVCRECHATCDGCTGPKDTIGIGACTTCNLAIINN 697

  Fly   214 STGSMHCKYLSD-LTSKKAWIFV------------------PCHGM----TNCSNNRSIIAE--- 252
            ......|....| ......|.:|                  .||.:    ||...:..:.::   
  Fly   698 DATVKRCLLKDDKCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTH 762

  Fly   253 -----------------DKDQLDFVNVRMEQEGW-------------YTCVESNSLG-QSNSTAY 286
                             |::|.:......|..|.             :...::|..| ..|||.:
  Fly   763 YKRREQCETECPADHYTDEEQRECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMF 827

  Fly   287 ---------LRVVRSLHVLEAGVASGSLHSTSFV-------YIFVFGGLIFIFMTTLFVFYAIRK 335
                     :|.|...:.......:.|...:|.:       .||:..|.:.:  .|:.:...:..
  Fly   828 NCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLV--PTICILCVVTY 890

  Fly   336 MKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDTMIMPVVRIQKQRTTVLQNGNEPAPFNE 400
            :..:| .|.:.|||                                  :.|..|....:..|.. 
  Fly   891 ICRQK-QKAKKETV----------------------------------KMTMALSGCEDSEPLR- 919

  Fly   401 YEFPLDSNWELPRSHLV------LGATLGEGAFGRVV----MAEVNNA--IVAVKMVKEGHTDDD 453
               |.:....|.:..:|      .|..||.||||||.    :.|..|.  .||:|.:.:....:.
  Fly   920 ---PSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAES 981

  Fly   454 IASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQ 518
            ....:||..:|..: .|:|::.||..| .:..:.:|.:..|.|.|.|::..||      |:    
  Fly   982 SEEFLREAYIMASV-EHVNLLKLLAVC-MSSQMMLITQLMPLGCLLDYVRNNR------DK---- 1034

  Fly   519 PPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQS 583
                     |..|.|:.::.|||:||.||..:|.:|||||||||||....::||.|||||:.:.|
  Fly  1035 ---------IGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSS 1090

  Fly   584 TDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLM 648
            .....|...|::||||:|.|.::.:.:.||||||::|:.:||::|:||:|:..| .|:::...:.
  Fly  1091 DSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENI-PAKDIPDLIE 1154

  Fly   649 SGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYLDVDIANLDTPPS-T 712
            .|.::|:|..||::||..:..|||.:|..||.|.::.....:..:....||.:........|: |
  Fly  1155 VGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYT 1219

  Fly   713 SDEEED 718
            |.:|:|
  Fly  1220 SQDEKD 1225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845 28/139 (20%)
IG_like 113..191 CDD:214653 28/138 (20%)
IG_like 205..289 CDD:214653 21/160 (13%)
PKc_like 404..692 CDD:304357 100/299 (33%)
STYKc 416..688 CDD:214568 98/283 (35%)
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382 11/39 (28%)
GF_recep_IV 572..684 CDD:291509 24/115 (21%)
FU 573..>606 CDD:238021 5/36 (14%)
FU 617..659 CDD:214589 12/41 (29%)
FU 662..716 CDD:214589 8/53 (15%)
FU 739..786 CDD:238021 6/46 (13%)
FU 784..834 CDD:214589 7/49 (14%)
PTKc_EGFR_like 930..1208 CDD:270648 100/299 (33%)
STYKc 938..1194 CDD:214568 97/277 (35%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455233
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.