DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Drl-2

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:269 Identity:84/269 - (31%)
Similarity:142/269 - (52%) Gaps:24/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 EGAFGRVVMAEVNNAIVA-VKMVKEGHTDDDIASLVREMEVMKIIG---RHINIINLLGCCSQNG 484
            ||.|||:...::..:..| ||.|.:|.:...:|.|:::..:  :||   :|| :..||......|
  Fly   389 EGTFGRIYAGKLGESCEALVKTVIDGASLTQVACLLQDASL--LIGVSHQHI-LAPLLANTELPG 450

  Fly   485 PLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLAS 549
            |..:...:...||||.:|.|:        |:||.        .::.:.|::|...|.:|:.||.|
  Fly   451 PPEIAYPHPSKGNLKMYLQKS--------RESST--------ALSTRQLVEFGLHITKGLAYLHS 499

  Fly   550 RRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKS 614
            ...:|:|:|.||..:.::..:||.|..|:||:...||.....|...|:||::.||||::.|.::.
  Fly   500 LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKRVYATQG 564

  Fly   615 DVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRP 679
            |||:.|:..||::|..|.|:..: ...||..||.:|.|:|:|..|....:.:|..|||..|..||
  Fly   565 DVWALGVTYWELVTLAQMPHEEV-DIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRP 628

  Fly   680 PFTEIVEYM 688
            ..::::.|:
  Fly   629 TPSQLLSYL 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 84/269 (31%)
STYKc 416..688 CDD:214568 83/267 (31%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 84/269 (31%)
STYKc 389..637 CDD:214568 83/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.