DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Fgfrl1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus


Alignment Length:297 Identity:81/297 - (27%)
Similarity:127/297 - (42%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GARSQNKTPAITNNANQSSTSSADLDDGAADDDDNKADLPVNVS-SKPYWRNPKKM-SFLQTRPS 117
            |:.|.|.|..|.::.:....:..........:|      ||:.. ::|.:..|.|| ..:..||.
  Rat   102 GSLSVNYTLIIMDDISPGKENPGPGGSSGGQED------PVSQQWARPRFTQPSKMRRRVIARPV 160

  Fly   118 GSLLTLNCHALGNPEPNITWYRNGTVDWTRGYGSLKRNRWTLTMEDLVPGDCGNYTCKVCNSLGC 182
            ||.:.|.|.|.|:|.|:|.|.::............::.:|||::::|.|.|.|.|||:|.|..|.
  Rat   161 GSSVRLKCVASGHPRPDIMWMKDDQTLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGA 225

  Fly   183 IRHDTQVIVSDRVNHKPILM-TGPLNLTLVVNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNN 246
            |....:|.|..|...||:|. |.|:|.|:....|.|..||..||:.....|:....:|.....|:
  Rat   226 INATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRHNS 290

  Fly   247 RSIIAEDK------------------DQLDFVNVRMEQEGWYTCVESNSLGQSNSTAYLRVVRSL 293
            ...:...|                  ::|.....|.:..|.|.|:.:|::|.|..:|:|.|:...
  Rat   291 TIDVGGQKFVVLPTGDVWSRPDGSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDP 355

  Fly   294 HVLEAGVASGSLHSTSFVYIFVFG---GLIFIFMTTL 327
            ......||..| .:||..:..|.|   |.:||..|.|
  Rat   356 KPPGPPVAHSS-STTSLPWPVVIGIPAGAVFILGTVL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 31/90 (34%)
Ig strand B 121..125 CDD:409353 1/3 (33%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 3/3 (100%)
Ig strand F 171..176 CDD:409353 3/4 (75%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 200..289 CDD:472250 25/107 (23%)
Ig strand B 216..220 CDD:409353 1/3 (33%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151 4/9 (44%)
Ig strand B 43..47 CDD:409390
Ig strand C 56..60 CDD:409390
Ig strand E 78..82 CDD:409390
Ig strand F 92..97 CDD:409390
Ig strand G 105..108 CDD:409390 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152 6/40 (15%)
IgI_2_FGFRL1-like 143..234 CDD:409442 31/90 (34%)
Ig strand A 143..146 CDD:409442 1/2 (50%)
Ig strand A' 154..159 CDD:409442 0/4 (0%)
Ig strand B 163..171 CDD:409442 2/7 (29%)
Ig strand C 177..182 CDD:409442 2/4 (50%)
Ig strand C' 185..187 CDD:409442 0/1 (0%)
Ig strand D 193..196 CDD:409442 0/2 (0%)
Ig strand E 200..205 CDD:409442 3/4 (75%)
Ig strand F 214..221 CDD:409442 4/6 (67%)
Ig strand G 224..234 CDD:409442 3/9 (33%)
Ig 242..350 CDD:472250 25/107 (23%)
Ig strand B 260..264 CDD:409363 1/3 (33%)
Ig strand C 273..277 CDD:409363 0/3 (0%)
Ig strand E 317..321 CDD:409363 1/3 (33%)
Ig strand F 331..336 CDD:409363 2/4 (50%)
Ig strand G 344..347 CDD:409363 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.