DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and dnt

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_477341.2 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:139/283 - (49%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 SNWELPRSHLVLGATLGEGAFGRVVMAEVNNA-IVAVKMVKEGHTDDDIASLVREMEVMKIIG-R 469
            |...:.|..:.|.:.|.||.||||.....|:. .|.||.|.:..:...:..|::  |.|.:.| .
  Fly   308 SELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQDVLVKTVAQHASQMQVLLLLQ--EGMLLYGAS 370

  Fly   470 HINIINLLGCCSQNGPLYVIVEYAPHG--NLKDFLYKNRPFGRDQDRDSSQPPPSPP-AHVITEK 531
            |..|:::||...::.....::..|.:.  |||.||.                  .|. |..:|..
  Fly   371 HPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLL------------------DPACARTVTTI 417

  Fly   532 DLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLP 596
            .::..|.|::..:|:|.|...:|:|:|.||.::.|...:|::|..|:||:..:||.....:...|
  Fly   418 QIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRP 482

  Fly   597 IKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSM 661
            :|||:.|:||.|.:...||.|::|:|:||:.|..:|||..: ...|:..||..|.|:.:|..|..
  Fly   483 VKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEV-DPFEMEHYLKDGYRLAQPFNCPD 546

  Fly   662 NIYILMRQCWHFNADDRPPFTEI 684
            .::.:|..||.....:||.|.::
  Fly   547 ELFTIMAYCWALLPAERPTFAQL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 82/283 (29%)
dntNP_477341.2 WIF 46..182 CDD:128745
Protein Kinases, catalytic domain 310..580 CDD:473864 81/281 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.