DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and styk1b

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001292494.1 Gene:styk1b / 324714 ZFINID:ZDB-GENE-030131-3435 Length:447 Species:Danio rerio


Alignment Length:344 Identity:91/344 - (26%)
Similarity:148/344 - (43%) Gaps:66/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 IQKQRTTVLQNGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNNAIVAVKMV 445
            :.:||.....||..|.|.: |....||...|.|                   |.:.|..|.::::
Zfish   134 LPRQRLPENFNGVAPLPAS-YSLKSDSPISLYR-------------------ARMENRNVVLRVL 178

  Fly   446 KEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNR---- 506
            |:..::.:..|.:.....:..:|.|..:..|||..|...||..::|...:.:|..||::.|    
Zfish   179 KDSASNQESQSFLGFAAFLSQLGPHPFLPELLGVISLRAPLITVIEEMENRDLLGFLWRCRQDNV 243

  Fly   507 -PFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVS----- 565
             |.|..|               :|||.:...|..:|..:|:|..:...|.:|.|||||||     
Zfish   244 GPDGMCQ---------------MTEKKIFNMASHVASALDFLHGKDLHHCNLKARNVLVSRICTA 293

  Fly   566 -----DDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWE 625
                 ||..::.:..|    ..|.|..||        ||.|||.|.::....|||:||:|:||:|
Zfish   294 KLWGLDDLYVRTSGSG----NYSEDPGRK--------KWQAPELLAKRPSTPKSDIWSFGLLLYE 346

  Fly   626 IMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDK 690
            ::|.|:.|:..| ..:||..:....:.:.||..||.::|.:::.|.|:...|||...|:   ..|
Zfish   347 MVTLGEVPFAEI-PVKELLQHHQRVKPIRKPNNCSNSLYSIIKSCCHWKEQDRPSLAEV---RRK 407

  Fly   691 LLQTKEDYLDVDIANLDTP 709
            |...::...|..:..:..|
Zfish   408 LQSGEKSASDSSVLRVPEP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 81/302 (27%)
STYKc 416..688 CDD:214568 76/286 (27%)
styk1bNP_001292494.1 PKc_like 164..409 CDD:304357 78/294 (27%)
Pkinase_Tyr 164..408 CDD:285015 77/293 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.