DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Map3k10

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001382027.1 Gene:Map3k10 / 308463 RGDID:1308381 Length:940 Species:Rattus norvegicus


Alignment Length:355 Identity:106/355 - (29%)
Similarity:162/355 - (45%) Gaps:61/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNNAIVAVKMVKEGHTDDDIASLVR 459
            ||...:.:.|    .|:|...|.|...:|.|.||:|..|......||||..:.....|...:..:
  Rat    81 PAAPTDLQLP----QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPERDPAVTAEQ 141

  Fly   460 EMEVMKIIG--RHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPS 522
            ..:..::.|  :|.|||.|.|.|.....|.:::|||..|.|...|...|                
  Rat   142 VRQEARLFGALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRR---------------- 190

  Fly   523 PPAHVITEKDLIKFAHQIARGMDYL---ASRRCIHRDLAARNVLVSD--------DYVLKIADFG 576
            .|.||     |:.:|.|:||||:||   |....|||||.:.|:|:.:        |.||||.|||
  Rat   191 VPPHV-----LVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFG 250

  Fly   577 LARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAE 641
            |||:...|.  :.:..|  ...|||||.::...:...|||||:|:||||::| |:.||..|.:..
  Rat   251 LAREWHKTT--KMSAAG--TYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALA 310

  Fly   642 ELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQT------------ 694
            ..|...|:...:..|:.|......|:.:||..:...||.|..|::.::.:.|:            
  Rat   311 VAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKQLEVIEQSALFQMPLESFHS 375

  Fly   695 -KEDYLDVDIANLDTPPSTSDEE----EDE 719
             :||: .::|.::.....|.::|    |:|
  Rat   376 LQEDW-KLEIQHMFDDLRTKEKELRSREEE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 96/300 (32%)
Map3k10NP_001382027.1 SH3_MLK1-3 20..76 CDD:212992
Protein Kinases, catalytic domain 103..360 CDD:473864 91/282 (32%)
Leucine-zipper 1 384..405 5/21 (24%)
Leucine-zipper 2 419..440
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..658
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 687..732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..916
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.