DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and flt4

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_571020.2 Gene:flt4 / 30121 ZFINID:ZDB-GENE-980526-326 Length:1368 Species:Danio rerio


Alignment Length:692 Identity:224/692 - (32%)
Similarity:322/692 - (46%) Gaps:152/692 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 FLQTRPSG--------------SLLTLNCHALGNPEPNITWYR---------------NGTVDWT 146
            ::.|.|.|              .|:.|.|:|......|:.|||               :....:.
Zfish   578 YVTTIPEGFDIEMEPSEDPLEQDLVQLKCNADNFTYENLRWYRLDPQTVPPELDCKSLHQYATFL 642

  Fly   147 RGYGSLK--RNRWTLTME--DLVPGDCGNYTCKVCNSLGCIRHDTQVIVSDRVNHKPILMTGPLN 207
            .|..|.:  .|.|.|.:.  ::...|.|||.|:|.|....::|..:..:..:....|.....|.|
Zfish   643 EGQLSFQTTSNNWVLQLNITNIQLQDEGNYVCEVQNRRTGVKHCHRKYIPVKAMEAPRYRHNPTN 707

  Fly   208 LTLVVNSTGSMHCKYLSDLTSKKAWI--FVPCHGMTNCSNNRSIIAEDKDQ-LDFVNVRMEQEGW 269
            .|:.|:.:..|:|........:.:|.  ..|.|.::      .|:.:|.:: |....||.|..|.
Zfish   708 HTVNVSESLQMNCDVEGTPFPQLSWFKDNQPLHQIS------GILLQDSNRTLSIQRVREEDAGL 766

  Fly   270 YTCVESNSLGQSNSTAYLRVVRSLHVLEAGVASGSLHSTSFVYIFVFG-GLIFIFMTTLFVFYAI 333
            |||...|..|...|:|.:.|:            ||...|:...:.:.| |:|.||.         
Zfish   767 YTCSACNQKGCVQSSATVSVI------------GSDDKTNVEIVILIGTGVIAIFF--------- 810

  Fly   334 RKMKHEKVLKQRIETVHQWTKKVIIF---KPEGGGD-SSGSMDTMIMP-VVRIQKQRTTVLQNGN 393
                              |...::||   |.....| .:|.:..::.| .|.:::|         
Zfish   811 ------------------WVLLLVIFCNVKRVNPADIKTGYLSIIMDPGEVPLEEQ--------- 848

  Fly   394 EPAPFNEYEFPLDSN-WELPRSHLVLGATLGEGAFGRVVMAEV-------NNAIVAVKMVKEGHT 450
                 .|| .|.||: ||:.|..|.||..||.||||:|:.|.:       :...|||||:|||.|
Zfish   849 -----CEY-LPYDSSQWEISRDRLRLGKVLGHGAFGKVIEASIFGHDKKSSANTVAVKMLKEGAT 907

  Fly   451 DDDIASLVREMEVMKIIGRHINIINLLGCCSQ-NGPLYVIVEYAPHGNLKDFLYKNRPF---GRD 511
            ..:..:|:.|::::..||.|:|::||||.|:: ||||.|||||..:|||.:||...|.|   .||
Zfish   908 ASEHKALMSELKILIHIGNHLNVVNLLGACTKPNGPLMVIVEYCKYGNLSNFLRAKREFFLPYRD 972

  Fly   512 Q-----------------DRDSSQPPPS---PPAHVI--------TEKDLIKFAHQIARGMDYLA 548
            :                 .:...||..|   ||...:        |.:|||.::.|:||||::||
Zfish   973 RSPKTQSQVRRMIEAGQASQSEHQPSTSSTNPPRVTVDDLWKTPLTIEDLICYSFQVARGMEFLA 1037

  Fly   549 SRRCIHRDLAARNVLVSDDYVLKIADFGLARDI-QSTDYYRKNTNGRLPIKWMAPESLQEKFYDS 612
            ||:||||||||||:|:|::.|:||.|||||||| :..||.||. |.|||:|||||||:.:|.|.|
Zfish  1038 SRKCIHRDLAARNILLSENNVVKICDFGLARDIYKDPDYVRKG-NARLPLKWMAPESIFDKVYTS 1101

  Fly   613 KSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADD 677
            :|||||:|:|||||.:.|..|||.|...|:....|..|.||..|...|..||.:|..||.....:
Zfish  1102 QSDVWSFGVLLWEIFSLGASPYPGIQIDEDFCKRLKDGTRMRAPDNASPEIYGIMLACWQGEPRE 1166

  Fly   678 RPPFTEIVEYMDKLLQTKEDYLDVDIANLDTPPSTSDEEEDE 719
            ||.|..:||.:..|||  |:.|.      :.|.:.|...||:
Zfish  1167 RPTFPALVEILGDLLQ--ENSLP------EIPFNVSQSSEDD 1200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 24/112 (21%)
Ig strand B 121..125 CDD:409353 1/3 (33%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 2/3 (67%)
Ig strand F 171..176 CDD:409353 3/4 (75%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 23/91 (25%)
Ig strand B 216..220 CDD:409353 1/3 (33%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/4 (25%)
Ig strand F 269..274 CDD:409353 3/4 (75%)
Ig strand G 282..285 CDD:409353 1/2 (50%)
Protein Kinases, catalytic domain 404..692 CDD:473864 147/328 (45%)
flt4NP_571020.2 IgI_VEGFR 249..350 CDD:409448
Ig strand A 249..253 CDD:409448
Ig strand A' 260..264 CDD:409448
Ig strand B 266..275 CDD:409448
Ig strand C 282..287 CDD:409448
Ig strand C' 290..292 CDD:409448
Ig strand D 296..304 CDD:409448
Ig strand E 310..318 CDD:409448
Ig strand F 328..334 CDD:409448
Ig strand G 339..345 CDD:409448
Ig 352..445 CDD:472250
Ig strand B 373..377 CDD:409353
Ig strand C 386..390 CDD:409353
Ig strand E 409..413 CDD:409353
Ig strand F 423..428 CDD:409353
Ig strand G 438..441 CDD:409353
IG_like 602..678 CDD:214653 18/75 (24%)
Ig strand B 602..606 CDD:409353 1/3 (33%)
Ig strand C 615..619 CDD:409353 1/3 (33%)
Ig strand E 657..661 CDD:409353 1/3 (33%)
Ig strand F 671..676 CDD:409353 3/4 (75%)
I-set 705..786 CDD:400151 23/86 (27%)
Ig strand B 716..720 CDD:409353 1/3 (33%)
Ig strand C 729..733 CDD:409353 0/3 (0%)
Ig strand E 752..756 CDD:409353 1/3 (33%)
Ig strand F 766..771 CDD:409353 3/4 (75%)
Ig strand G 779..782 CDD:409353 1/2 (50%)
VEGFR-2_TMD 791..825 CDD:375470 10/60 (17%)
Protein Kinases, catalytic domain 858..1184 CDD:473864 147/328 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 978..1007 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1192..1212 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.